YAP1 (NM_001130145) Human Recombinant Protein
CAT#: TP325864
Purified recombinant protein of Homo sapiens Yes-associated protein 1, 65kDa (YAP1), transcript variant 1, 20 µg
View other "YAP1" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225864 representing NM_001130145
Red=Cloning site Green=Tags(s) MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFN AVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPG TLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQM NVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVK QPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRS QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVL AATKLDKESFLTWL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001123617 |
Locus ID | 10413 |
UniProt ID | P46937, Q86T74 |
Cytogenetics | 11q22.1 |
Refseq ORF | 1512 |
Synonyms | COB1; YAP; YAP2; YAP65; YKI |
Summary | This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401842 | YAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC434268 | YAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401842 | Transient overexpression lysate of Yes-associated protein 1, 65kDa (YAP1), transcript variant 2 |
USD 665.00 |
|
LY434268 | Transient overexpression lysate of Yes-associated protein 1 (YAP1), transcript variant 3 |
USD 436.00 |
|
PH325864 | YAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001123617) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review