FAM136B (NM_001012983) Human Recombinant Protein
CAT#: TP325113
Recombinant protein of human family with sequence similarity 136, member B (FAM136B), 20 µg
View other "FAM136B" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225113 representing NM_001012983
Red=Cloning site Green=Tags(s) MVELQQLRVQEVVDSMVKSLERENIWKTQGLMFWCSASCCEDSQAFTQQVHQCIECCPVPLAQVQALVTS ELEKFQDHLARCTMHCNDKAKDSIDAGSKELQVKQQLDGCVTKCVDDHIHLISTMTKKMKEAVLSIGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001013001 |
Locus ID | 387071 |
Cytogenetics | 6p25.2 |
Refseq ORF | 414 |
Synonyms | C6orf87; dJ40E16.3 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC425341 | FAM136B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY425341 | Transient overexpression lysate of family with sequence similarity 136, member B (FAM136B) |
USD 436.00 |
|
PH325113 | FAM136B MS Standard C13 and N15-labeled recombinant protein (NP_001013001) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review