Flt3 ligand (FLT3LG) (NM_001459) Human Recombinant Protein

CAT#: TP322242

Reviews ()
Write a review

Recombinant protein of human fms-related tyrosine kinase 3 ligand (FLT3LG)



USD 439.00


Availability*
In Stock

Size
    • 20 ug


Product images

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC222242 protein sequence
Red=Cloning site Green=Tags(s)

MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELC
GGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVA
LKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRT
RRRTPRPGEQVPPVPSPQDLLLVEH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.2 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Bioactivity FLT-3LG generate dendritic cell differentiation: Fms-like tyrosine kinase 3 ligand (Flt3L) is a nonredundant cytokine required for dendritic cell (DC) homeostasis in lymphoid tissues. FLT3L is commonly used to generate pDCs in vitro.In this experiment, 300,000 unfractioned mouse bone marrow cells were cultured with purified recombinant human FLT-3L (OriGene, TP322242) at indicated concentrations. Total live cells were counted at the day 8.
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001450
Locus ID 2323
UniProt ID P49771
Cytogenetics 19q13.33
Refseq Size 1074
Refseq ORF 705
Synonyms FL; FLG3L; FLT3L
Summary Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).[supplied by OMIM, Jan 2011]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Pathways in cancer

Documents

Other products for "FLT3LG"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.