SNRPB (NM_198216) Human Recombinant Protein
CAT#: TP320701
Recombinant protein of human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, 20 µg
View other "SNRPB" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220701 representing NM_198216
Red=Cloning site Green=Tags(s) MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLV LLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQ VMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRG TPMGMPPPGMRPPPPGMRGPPPPGMRPPRP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_937859 |
Locus ID | 6628 |
UniProt ID | P14678 |
Cytogenetics | 20p13 |
Refseq Size | 1007 |
Refseq ORF | 720 |
Synonyms | CCMS; COD; Sm-B/B'; SmB/B'; SmB/SmB'; snRNP-B; SNRPB1 |
Summary | The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome, Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404878 | SNRPB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418902 | SNRPB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404878 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1 |
USD 436.00 |
|
LY418902 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2 |
USD 436.00 |
|
PH320701 | SNRPB MS Standard C13 and N15-labeled recombinant protein (NP_937859) |
USD 3,255.00 |
|
TP761620 | Purified recombinant protein of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review