CAMK2D (NM_172115) Human Recombinant Protein
CAT#: TP318801
Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 4, 20 µg
View other "CAMK2D" proteins (13)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218801 representing NM_172115
Red=Cloning site Green=Tags(s) MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKH PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPE NLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVG YPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVAS MMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEI IKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_742113 |
Locus ID | 817 |
UniProt ID | Q13557, A8MVS8 |
Cytogenetics | 4q26 |
Refseq Size | 2151 |
Refseq ORF | 1434 |
Synonyms | CAMKD |
Summary | The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a delta chain. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Distinct isoforms of this chain have different expression patterns.[provided by RefSeq, Nov 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406847 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC406848 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC406849 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC430342 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406847 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 4 |
USD 436.00 |
|
LY406848 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 1 |
USD 436.00 |
|
LY406849 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 2 |
USD 436.00 |
|
LY430342 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 5 |
USD 436.00 |
|
PH307454 | CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742125) |
USD 3,255.00 |
|
PH318801 | CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742113) |
USD 3,255.00 |
|
PH322121 | CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742126) |
USD 3,255.00 |
|
TP307454 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 1, 20 µg |
USD 867.00 |
|
TP322121 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review