SPRR2F (NM_001014450) Human Recombinant Protein
CAT#: TP316115
Recombinant protein of human small proline-rich protein 2F (SPRR2F), 20 µg
View other "SPRR2F" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216115 representing NM_001014450
Red=Cloning site Green=Tags(s) MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPK SK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001014450 |
Locus ID | 6705 |
UniProt ID | Q96RM1 |
Cytogenetics | 1q21.3 |
Refseq Size | 657 |
Refseq ORF | 216 |
Summary | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423073 | SPRR2F HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY423073 | Transient overexpression lysate of small proline-rich protein 2F (SPRR2F) |
USD 436.00 |
|
PH316115 | SPRR2F MS Standard C13 and N15-labeled recombinant protein (NP_001014450) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review