Alcohol Dehydrogenase (ADH1A) (NM_000667) Human Recombinant Protein
CAT#: TP315367
Recombinant protein of human alcohol dehydrogenase 1A (class I), alpha polypeptide (ADH1A), 20 µg
View other "Alcohol Dehydrogenase" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215367 representing NM_000667
Red=Cloning site Green=Tags(s) MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVTPLPVILGHEA AGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHH FVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVM GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL LCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNI LPFEKINEGFDLLRSGKSIRTILMF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000658 |
Locus ID | 124 |
UniProt ID | P07327 |
Cytogenetics | 4q23 |
Refseq Size | 1456 |
Refseq ORF | 1125 |
Synonyms | ADH1 |
Summary | This gene encodes a member of the alcohol dehydrogenase family. The encoded protein is the alpha subunit of class I alcohol dehydrogenase, which consists of several homo- and heterodimers of alpha, beta and gamma subunits. Alcohol dehydrogenases catalyze the oxidation of alcohols to aldehydes. This gene is active in the liver in early fetal life but only weakly active in adult liver. This gene is found in a cluster with six additional alcohol dehydrogenase genes, including those encoding the beta and gamma subunits, on the long arm of chromosome 4. Mutations in this gene may contribute to variation in certain personality traits and substance dependence. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Fatty acid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424579 | ADH1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424579 | Transient overexpression lysate of alcohol dehydrogenase 1A (class I), alpha polypeptide (ADH1A) |
USD 436.00 |
|
PH315367 | ADH1A MS Standard C13 and N15-labeled recombinant protein (NP_000658) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review