Cysteine Dioxygenase Type 1 (CDO1) (NM_001801) Human Recombinant Protein
CAT#: TP306067
Recombinant protein of human cysteine dioxygenase, type I (CDO1), 20 µg
View other "Cysteine Dioxygenase Type 1" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206067 protein sequence
Red=Cloning site Green=Tags(s) MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKF NLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLH RVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001792 |
Locus ID | 1036 |
UniProt ID | Q16878 |
Cytogenetics | 5q22.3 |
Refseq Size | 1627 |
Refseq ORF | 600 |
Synonyms | CDO-I |
Summary | Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways, Taurine and hypotaurine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419737 | CDO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419737 | Transient overexpression lysate of cysteine dioxygenase, type I (CDO1) |
USD 436.00 |
|
PH306067 | CDO1 MS Standard C13 and N15-labeled recombinant protein (NP_001792) |
USD 3,255.00 |
|
TP720520 | Recombinant protein of human cysteine dioxygenase, type I (CDO1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review