Osteopontin (SPP1) (NM_001040058) Human Recombinant Protein
CAT#: TP304803
Purified recombinant protein of Homo sapiens secreted phosphoprotein 1 (SPP1), transcript variant 1, 20 µg
View other "Osteopontin" proteins (13)
Special Offer: Buy 2 proteins and get the third protein free. Use code: "3for2". Get details here »
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204803 protein sequence
Red=Cloning site Green=Tags(s) MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFK QETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDL PATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQD LNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHS HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Cell treatment (PMID: 29959420) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035147 |
Locus ID | 6696 |
UniProt ID | P10451, A0A024RDE2 |
Cytogenetics | 4q22.1 |
Refseq Size | 1641 |
Refseq ORF | 942 |
Synonyms | BNSP; BSPI; ETA-1; OPN |
Summary | The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | ECM-receptor interaction, Focal adhesion, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400422 | SPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421887 | SPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424632 | SPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400422 | Transient overexpression lysate of secreted phosphoprotein 1 (SPP1), transcript variant 3 |
USD 436.00 |
|
LY421887 | Transient overexpression lysate of secreted phosphoprotein 1 (SPP1), transcript variant 1 |
USD 436.00 |
|
LY424632 | Transient overexpression lysate of secreted phosphoprotein 1 (SPP1), transcript variant 2 |
USD 436.00 |
|
PH304803 | SPP1 MS Standard C13 and N15-labeled recombinant protein (NP_001035147) |
USD 3,255.00 |
|
PH305118 | SPP1 MS Standard C13 and N15-labeled recombinant protein (NP_000573) |
USD 3,255.00 |
|
PH310592 | SPP1 MS Standard C13 and N15-labeled recombinant protein (NP_001035149) |
USD 3,255.00 |
|
TP305118 | Purified recombinant protein of Homo sapiens secreted phosphoprotein 1 (SPP1), transcript variant 2, 20 µg |
USD 867.00 |
|
TP310592 | Purified recombinant protein of human secreted phosphoprotein 1 (SPP1), transcript variant 3, with C-terminal MYC/DDK tag, secretory expressed in HEK293 cells, 20 µg |
USD 867.00 |
|
TP710213 | Purified protein of Homo sapiens secreted phosphoprotein 1 (SPP1), transcript variant 1, residues 17-314aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 515.00 |
|
TP720449 | Recombinant protein of human secreted phosphoprotein 1 (SPP1), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review