RBCK1 (NM_031229) Human Recombinant Protein
CAT#: TP303906
Recombinant protein of human RanBP-type and C3HC4-type zinc finger containing 1 (RBCK1), transcript variant 2, 20 µg
View other "RBCK1" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203906 representing NM_031229
Red=Cloning site Green=Tags(s) MALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMT VASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLR MLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRAR PEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLA PGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISI AENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQ TTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGI PCHPSCQNCH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Enzyme substrate (PMID: 26525107) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112506 |
Locus ID | 10616 |
UniProt ID | Q9BYM8, Q86SL2 |
Cytogenetics | 20p13 |
Refseq Size | 2778 |
Refseq ORF | 1500 |
Synonyms | C20orf18; HOIL-1; HOIL1; PBMEI; PGBM1; RBCK2; RNF54; UBCE7IP3; XAP3; XAP4; ZRANB4 |
Summary | The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410596 | RBCK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC416627 | RBCK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY410596 | Transient overexpression lysate of RanBP-type and C3HC4-type zinc finger containing 1 (RBCK1), transcript variant 2 |
USD 436.00 |
|
LY416627 | Transient overexpression lysate of RanBP-type and C3HC4-type zinc finger containing 1 (RBCK1), transcript variant 1 |
USD 665.00 |
|
PH303906 | RBCK1 MS Standard C13 and N15-labeled recombinant protein (NP_112506) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review