EIF3K (NM_013234) Human Recombinant Protein
CAT#: TP303529
Recombinant protein of human eukaryotic translation initiation factor 3, subunit K (EIF3K), 20 µg
View other "EIF3K" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203529 protein sequence
Red=Cloning site Green=Tags(s) MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQIL LKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRK FICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSV SSIMASSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037366 |
Locus ID | 27335 |
UniProt ID | Q9UBQ5 |
Cytogenetics | 19q13.2 |
Refseq Size | 898 |
Refseq ORF | 654 |
Synonyms | ARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001 |
Summary | The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415721 | EIF3K HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415721 | Transient overexpression lysate of eukaryotic translation initiation factor 3, subunit K (EIF3K) |
USD 436.00 |
|
PH303529 | EIF3K MS Standard C13 and N15-labeled recombinant protein (NP_037366) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review