Triosephosphate isomerase (TPI1) (NM_000365) Human Recombinant Protein
CAT#: TP302652
Recombinant protein of human triosephosphate isomerase 1 (TPI1), 20 µg
View other "Triosephosphate isomerase" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202652 protein sequence
Red=Cloning site Green=Tags(s) MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKV TNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGIT EKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYG GSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.5 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000356 |
Locus ID | 7167 |
UniProt ID | P60174, Q53HE2, V9HWK1 |
Cytogenetics | 12p13.31 |
Refseq Size | 1366 |
Refseq ORF | 747 |
Synonyms | HEL-S-49; TIM; TPI; TPID |
Summary | This gene encodes an enzyme, consisting of two identical proteins, which catalyzes the isomerization of glyceraldehydes 3-phosphate (G3P) and dihydroxy-acetone phosphate (DHAP) in glycolysis and gluconeogenesis. Mutations in this gene are associated with triosephosphate isomerase deficiency. Pseudogenes have been identified on chromosomes 1, 4, 6 and 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
Protein Pathways | Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Inositol phosphate metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424764 | TPI1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424764 | Transient overexpression lysate of triosephosphate isomerase 1 (TPI1), transcript variant 1 |
USD 436.00 |
|
PH302652 | TPI1 MS Standard C13 and N15-labeled recombinant protein (NP_000356) |
USD 3,255.00 |
|
TP720233 | Recombinant protein of human triosephosphate isomerase 1 (TPI1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review