KEAP1 (NM_203500) Human Recombinant Protein
CAT#: TP302189
Recombinant protein of human kelch-like ECH-associated protein 1 (KEAP1), transcript variant 1, 20 µg
View other "KEAP1" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202189 protein sequence
Red=Cloning site Green=Tags(s) MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNEL RLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFA YTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMH FGEVAKQEEFFNLSHCQLVTLISRDDLNVRCESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNF LQMQLQKCEILQSDSRCKDYLVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDG TWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECY YPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGIT VHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.5 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_987096 |
Locus ID | 9817 |
UniProt ID | Q14145, A0A024R7C0 |
Cytogenetics | 19p13.2 |
Refseq Size | 2606 |
Refseq ORF | 1872 |
Synonyms | INrf2; KLHL19 |
Summary | This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402183 | KEAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404250 | KEAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402183 | Transient overexpression lysate of kelch-like ECH-associated protein 1 (KEAP1), transcript variant 2 |
USD 436.00 |
|
LY404250 | Transient overexpression lysate of kelch-like ECH-associated protein 1 (KEAP1), transcript variant 1 |
USD 436.00 |
|
PH302189 | KEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_987096) |
USD 3,255.00 |
|
PH302513 | KEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_036421) |
USD 3,255.00 |
|
TP302513 | Recombinant protein of human kelch-like ECH-associated protein 1 (KEAP1), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review