RPIA (NM_144563) Human Recombinant Protein
CAT#: TP302183
Recombinant protein of human ribose 5-phosphate isomerase A (RPIA), 20 µg
View other "RPIA" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202183 representing NM_144563
Red=Cloning site Green=Tags(s) MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTSTSCGDSNSICP APSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLIL QYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDQWH KGIPIEVIPMAYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPG VVDTGLFINMAERVYFGMQDGSVNMREKPFC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_653164 |
Locus ID | 22934 |
UniProt ID | P49247 |
Cytogenetics | 2p11.2 |
Refseq Size | 1834 |
Refseq ORF | 933 |
Synonyms | RPI; RPIAD |
Summary | The protein encoded by this gene is an enzyme, which catalyzes the reversible conversion between ribose-5-phosphate and ribulose-5-phosphate in the pentose-phosphate pathway. This gene is highly conserved in most organisms. The enzyme plays an essential role in the carbohydrate metabolism. Mutations in this gene cause ribose 5-phosphate isomerase deficiency. A pseudogene is found on chromosome 18. [provided by RefSeq, Mar 2010] |
Protein Pathways | Metabolic pathways, Pentose phosphate pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408273 | RPIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408273 | Transient overexpression lysate of ribose 5-phosphate isomerase A (RPIA) |
USD 436.00 |
|
PH302183 | RPIA MS Standard C13 and N15-labeled recombinant protein (NP_653164) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review