Josephin 1 (JOSD1) (NM_014876) Human Recombinant Protein
CAT#: TP301968
Recombinant protein of human Josephin domain containing 1 (JOSD1), 20 µg
View other "Josephin 1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201968 protein sequence
Red=Cloning site Green=Tags(s) MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVT PHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHW ICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055691 |
Locus ID | 9929 |
UniProt ID | Q15040, A0A024R1P5 |
Cytogenetics | 22q13.1 |
Refseq Size | 3435 |
Refseq ORF | 606 |
Synonyms | dJ508I15.2 |
Summary | Deubiquitinates monoubiquitinated probes (in vitro). When ubiquitinated, cleaves 'Lys-63'-linked and 'Lys-48'-linked poly-ubiquitin chains (in vitro), hence may act as a deubiquitinating enzyme. May increase macropinocytosis and suppress clathrin- and caveolae-mediated endocytosis. May enhance membrane dynamics and cell motility independently of its catalytic activity.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414963 | JOSD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414963 | Transient overexpression lysate of Josephin domain containing 1 (JOSD1) |
USD 436.00 |
|
PH301968 | JOSD1 MS Standard C13 and N15-labeled recombinant protein (NP_055691) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review