SCAND1 (NM_033630) Human Recombinant Protein
CAT#: TP300079
Recombinant protein of human SCAN domain containing 1 (SCAND1), transcript variant 2, 20 µg
View other "SCAND1" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200079 protein sequence
Red=Cloning site Green=Tags(s) MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEAIPTPRAAASA ALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAAGPREAFRQLRELSRQWLRPD IRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_361012 |
Locus ID | 51282 |
UniProt ID | P57086, H0UIA5, Q9NZG6 |
Cytogenetics | 20q11.23 |
Refseq Size | 919 |
Refseq ORF | 537 |
Synonyms | RAZ1; SDP1 |
Summary | This gene encodes a SCAN box domain-containing protein. The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. This protein binds to and may regulate the function of the transcription factor myeloid zinc finger 1B. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409491 | SCAND1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC413912 | SCAND1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409491 | Transient overexpression lysate of SCAN domain containing 1 (SCAND1), transcript variant 2 |
USD 436.00 |
|
LY413912 | Transient overexpression lysate of SCAN domain containing 1 (SCAND1), transcript variant 1 |
USD 436.00 |
|
PH300079 | SCAND1 MS Standard C13 and N15-labeled recombinant protein (NP_361012) |
USD 3,255.00 |
|
PH304370 | SCAND1 MS Standard C13 and N15-labeled recombinant protein (NP_057642) |
USD 3,255.00 |
|
TP304370 | Recombinant protein of human SCAN domain containing 1 (SCAND1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review