FGF basic / FGF2 Rat Protein

CAT#: AR31055PU-L

Reviews ()
Write a review

FGF basic / FGF2 rat recombinant protein, 50 µg



USD 270.00


Availability*
2 Weeks

Size
    • 50 ug


Product images

Specifications

Product Data
Description FGF basic / FGF2 rat recombinant protein, 50 µg
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKGPGQKAILFLPMSAKS
Result by N-terminal sequencing: ALPEDGGGAFPP
Predicted MW 16.34 kDa
Purity >98% pure by SDS-PAGE
Buffer Presentation State: Purified
State: Lyophilized freeze dried protein without additives.
Buffer System: 0.5x PBS without stabilizers
Bioactivity Biological: The activity was determined by the stimulation of HUVE cells. The ED50 for this effect is ≤ 0.1ng/ml corresponding to a specific activity of ≥ 1 x 10e7 units/mg.
Endotoxin < 0.1ng per μg of Rat FGF-2
Reconstitution Restore with ddH2O at 50 μg/ml.
This solution can be diluted into other buffered solutions or stored frozen for future use.
Preparation Lyophilized freeze dried protein without additives.
Protein Description Recombinant Rat Fibroblast Growth Factor-2. The cDNA of native rat FGF-2 (Ala11-Ser154) was cloned from total RNA derived from a rat embryo using standard protocols.
Storage The lyophilized Rat FGF-2, though stable at room temperature, is best stored in working aliquots at –20°C to –70°C.
Avoid repeated freeze-thaw cycles!
Reference Data
RefSeq NP_062178
Locus ID 54250
Cytogenetics 2q25
Synonyms bFGF; Fgf-2
Summary activates the MAP kinase signaling pathway; plays a role in synaptic transmission; induces cell proliferation [RGD, Feb 2006]

Documents

Other products for "Fgf2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools