VEGF-C / Flt4-L

CAT#: AR01001PU-N

The recombinant Human VEGF-C contains 129 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.


 Product Datasheet for 'AR01001PU-N'

  View other "Vegfc" proteins (5)

Use code "PROTEIN10" to save 10%

USD 280.00


Availability*
2 Weeks

Size
    • 20 ug


Product images

Specifications

Product Data
Description The recombinant Human VEGF-C contains 129 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.
Species Rat
Expression Host Sf9
Expression cDNA Clone or AA Sequence DPTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVT ISFANHTSCRCMSKLHHHHHH
Tag Tag Free
Predicted MW 18-24 kDa
Purity > 90 % pure by SDS-PAGE and visualised by silver stain
Buffer PBS containing BSA (50-fold) as stabilizer
Bioactivity Determined (i) by the ability to induce VEGFR-3/FLT-4 receptor phosphorylation in PAEC/VEGFR-3 cells and (ii) the VEGF-C-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC).
Endotoxin < 0.1 ng per µg of VEGF-C
Reconstitution Restore in PBS or medium to a concentration not lower than 50 µg/ml.
Preparation Lyophilized protein
Reference Data
RefSeq NP_446105
Locus ID 114111

Documents

Other Versions

Other products for "Vegfc"
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies