C21ORF56 (SPATC1L) (NM_032261) Human Mass Spec Standard

CAT#: PH324562

C21orf56 MS Standard C13 and N15-labeled recombinant protein (NP_115637)

Product Images

Coomassie blue staining of purified SPATC1L protein (Cat# TP324562). The protein was produced from HEK293T cells transfected with SPATC1L cDNA clone (Cat# RC224562) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224562
• Predicted MW: 21 kDa
• Protein Sequence:
  Sequence Link

  >RC224562 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLDRRILAYVFPGVTRLYGFTVA
  NIPEKIEQTSTKSLDGSVDERKLRELTQRYLALSARLEKLGYSRDVHPAFSEFLINTYGILKQRPDLRAN
  PLHSSPAALRKLVIDVVPPKFLGDSLLLLNCLCELSKEDGKPLFAW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115637
• RefSeq Size: 1181
• RefSeq ORF: 558
• Synonyms: C21orf56
• Locus ID: 84221
• UniProt ID: Q9H0A9
• Cytogenetics: 21q22.3