OCM2 (NM_006188) Human Mass Spec Standard
CAT#: PH324075
OCM2 MS Standard C13 and N15-labeled recombinant protein (NP_006179)
Frequently bought together (1)
Other products for "OCM2"
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224075 |
Predicted MW | 12.2 kDa |
Protein Sequence |
>RC224075 protein sequence
Red=Cloning site Green=Tags(s) MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQK FESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006179 |
RefSeq Size | 588 |
RefSeq ORF | 327 |
Synonyms | OCM; OM |
Locus ID | 4951 |
UniProt ID | P0CE71 |
Cytogenetics | 7q21.3 |
Summary | This gene is similar to the oncomodulin gene, a high-affinity calcium ion-binding protein that belongs to the superfamily of calmodulin proteins, also known as the EF-hand proteins. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.