C11orf20 (TEX40) (NM_001039496) Human Mass Spec Standard

CAT#: PH320639

C11orf20 MS Standard C13 and N15-labeled recombinant protein (NP_001034585)

Product Images

Coomassie blue staining of purified CATSPERZ protein (Cat# TP320639). The protein was produced from HEK293T cells transfected with CATSPERZ cDNA clone (Cat# RC220639) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220639
• Predicted MW: 22.7 kDa
• Protein Sequence:
  Sequence Link

  >RC220639 representing NM_001039496
  Red=Cloning site Green=Tags(s)
  
  MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGR
  GSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAE
  QQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN
  
  TRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001034585
• RefSeq Size: 764
• RefSeq ORF: 600
• Synonyms: C11orf20; TEX40
• Locus ID: 25858
• UniProt ID: Q9NTU4
• Cytogenetics: 11q13.1
• Summary: Auxiliary component of the CatSper complex, a complex involved in sperm cell hyperactivation. Sperm cell hyperactivation is needed for sperm motility which is essential late in the preparation of sperm for fertilization. Required for a distribution of the CatSper complex in linear quadrilateral nanodomains along the flagellum, maximizing fertilization inside the mammalian female reproductive tract. Together with EFCAB9, associates with the CatSper channel pore and is required for the two-row structure of each single CatSper channel.[UniProtKB/Swiss-Prot Function]