OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HAO2 (NM_001005783) Human Mass Spec Standard

Be the first to review this product
SKU
PH318416
HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005783)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346057 Rabbit Polyclonal Anti-HAO2 Antibody
100 ul
$585.00
LY423655 Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "HAO2 or NM_001005783"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218416
Predicted MW 38.8 kDa
Protein Sequence
Protein Sequence
>RC218416 protein sequence
Red=Cloning site Green=Tags(s)

MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS
APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ
LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW
FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV
RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR
L

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001005783
RefSeq Size 1708
RefSeq ORF 1053
Synonyms GIG16; HAOX2
Locus ID 51179
UniProt ID Q9NYQ3
Cytogenetics 1p12
Summary This gene is one of three related genes that have 2-hydroxyacid oxidase activity. The encoded protein localizes to the peroxisome has the highest activity toward the substrate 2-hydroxypalmitate. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2014
Protein Pathways Glyoxylate and dicarboxylate metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HAO2" proteins (7)
SKU Description Size Price
PH305051 HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_057611) 10 ug
$3,360.00
LC413922 Lyophilized HAO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423655 Lyophilized HAO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413922 Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423655 Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305051 Recombinant protein of human hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1, 20 µg 20 ug
$737.00
TP318416 Purified recombinant protein of Homo sapiens hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products