HAO2 (NM_001005783) Human Mass Spec Standard
CAT#: PH318416
HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005783)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218416 |
Predicted MW | 38.8 kDa |
Protein Sequence |
>RC218416 protein sequence
Red=Cloning site Green=Tags(s) MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR L myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001005783 |
RefSeq Size | 1708 |
RefSeq ORF | 1053 |
Synonyms | GIG16; HAOX2 |
Locus ID | 51179 |
UniProt ID | Q9NYQ3 |
Cytogenetics | 1p12 |
Summary | This gene is one of three related genes that have 2-hydroxyacid oxidase activity. The encoded protein localizes to the peroxisome has the highest activity toward the substrate 2-hydroxypalmitate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413922 | HAO2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423655 | HAO2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413922 | Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1 |
USD 436.00 |
|
LY423655 | Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2 |
USD 436.00 |
|
PH305051 | HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_057611) |
USD 3,255.00 |
|
TP305051 | Recombinant protein of human hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1, 20 µg |
USD 867.00 |
|
TP318416 | Purified recombinant protein of Homo sapiens hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review