IKK gamma (IKBKG) (NM_001099856) Human Mass Spec Standard
CAT#: PH312996
IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_001093326)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212996 |
Predicted MW | 48 kDa |
Protein Sequence |
>RC212996 representing NM_001099856
Red=Cloning site Green=Tags(s) MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQ ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKA SVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES ARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001093326 |
RefSeq Size | 2073 |
RefSeq ORF | 1257 |
Synonyms | AMCBX1; EDAID1; FIP-3; FIP3; Fip3p; IKK-gamma; IKKAP1; IKKG; IMD33; IP; IP1; IP2; IPD2; NEMO; ZC2HC9 |
Locus ID | 8517 |
UniProt ID | Q9Y6K9 |
Cytogenetics | Xq28 |
Summary | This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, MAPK signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Primary immunodeficiency, Prostate cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, T cell receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400446 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC401206 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420210 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC428764 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400446 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 2 |
USD 665.00 |
|
LY401206 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3 |
USD 436.00 |
|
LY420210 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1 |
USD 665.00 |
|
LY428764 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 4 |
USD 436.00 |
|
PH301743 | IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_003630) |
USD 3,255.00 |
|
PH318044 | IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_001093327) |
USD 3,255.00 |
|
PH326825 | IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_001138727) |
USD 3,255.00 |
|
TP301743 | Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3, 20 µg |
USD 867.00 |
|
TP312996 | Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 2, 20 µg |
USD 867.00 |
|
TP318044 | Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1, 20 µg |
USD 867.00 |
|
TP326825 | Purified recombinant protein of Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 4, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review