IRF5 (NM_002200) Human Mass Spec Standard
CAT#: PH312461
IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_002191)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212461 |
Predicted MW | 56.5 kDa |
Protein Sequence |
>RC212461 representing NM_002200
Red=Cloning site Green=Tags(s) MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA GEEEEEEEELQRMLPSLSLTDAVQSGPHMTPYSLLKEDVKWPPTLQPPTLQPPVVLGPPAPDPSPLAPPP GNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRL FYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKV FWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLI TVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLG VGQGPWPMHPAGMQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002191 |
RefSeq Size | 2870 |
RefSeq ORF | 1512 |
Synonyms | interferon regulatory factor 5; SLEB10 |
Locus ID | 3663 |
UniProt ID | Q13568 |
Cytogenetics | 7q32.1 |
Summary | This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. [provided by RefSeq, Dec 2016] |
Protein Families | Transcription Factors |
Protein Pathways | Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403185 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419472 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420650 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420651 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420652 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420653 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420654 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC426034 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403185 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 2 |
USD 436.00 |
|
LY419472 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 1 |
USD 665.00 |
|
LY420650 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 3 |
USD 665.00 |
|
LY420651 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 4 |
USD 665.00 |
|
LY420652 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 5 |
USD 665.00 |
|
LY420653 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 6 |
USD 665.00 |
|
LY420654 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 7 |
USD 665.00 |
|
PH300458 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_116032) |
USD 3,255.00 |
|
PH311941 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092099) |
USD 3,255.00 |
|
PH315434 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092097) |
USD 3,255.00 |
|
PH315781 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092100) |
USD 3,255.00 |
|
PH316039 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092101) |
USD 3,255.00 |
|
PH316505 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092098) |
USD 3,255.00 |
|
TP300458 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 2, 20 µg |
USD 867.00 |
|
TP311941 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 5, 20 µg |
USD 867.00 |
|
TP312461 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 1, 20 µg |
USD 867.00 |
|
TP315434 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 3, 20 µg |
USD 867.00 |
|
TP315781 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 6, 20 µg |
USD 867.00 |
|
TP316039 | Purified recombinant protein of Homo sapiens interferon regulatory factor 5 (IRF5), transcript variant 7, 20 µg |
USD 867.00 |
|
TP316505 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 4, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review