HERPUD1 (NM_014685) Human Mass Spec Standard
CAT#: PH311835
HERPUD1 MS Standard C13 and N15-labeled recombinant protein (NP_055500)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211835 |
Predicted MW | 43.5 kDa |
Protein Sequence |
>RC211835 representing NM_014685
Red=Cloning site Green=Tags(s) MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLR DLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWE NISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAP APAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSI LYFYSSLSRFLMVMGATVVMYLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHL PPDRDVLDGEQTSPSFMSTAWLVFKTFFASLLPEGPPAIAN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055500 |
RefSeq Size | 2198 |
RefSeq ORF | 1173 |
Synonyms | HERP; Mif1; SUP |
Locus ID | 9709 |
UniProt ID | Q15011, Q53FP9 |
Cytogenetics | 16q13 |
Summary | The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response. This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involved in polypeptide folding, known as the unfolded protein response (UPR), and the destruction of misfolded proteins by the ER-associated protein degradation (ERAD) system. This gene may play a role in both UPR and ERAD. Its expression is induced by UPR and it has an ER stress response element in its promoter region while the encoded protein has an N-terminal ubiquitin-like domain which may interact with the ERAD system. This protein has been shown to interact with presenilin proteins and to increase the level of amyloid-beta protein following its overexpression. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms. The full-length nature of all transcript variants has not been determined. [provided by RefSeq, Jan 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402364 | HERPUD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423260 | HERPUD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423261 | HERPUD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402364 | Transient overexpression lysate of homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 1 |
USD 436.00 |
|
LY423260 | Transient overexpression lysate of homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 2 |
USD 436.00 |
|
LY423261 | Transient overexpression lysate of homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 3 |
USD 436.00 |
|
PH300693 | HERPUD1 MS Standard C13 and N15-labeled recombinant protein (NP_001010989) |
USD 3,255.00 |
|
PH317811 | HERPUD1 MS Standard C13 and N15-labeled recombinant protein (NP_001010990) |
USD 3,255.00 |
|
TP300693 | Recombinant protein of human homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 2, 20 µg |
USD 867.00 |
|
TP311835 | Recombinant protein of human homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 1, 20 µg |
USD 867.00 |
|
TP317811 | Purified recombinant protein of Homo sapiens homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review