XAGE2 (NM_130777) Human Mass Spec Standard
CAT#: PH309757
XAGE2 MS Standard C13 and N15-labeled recombinant protein (NP_570133)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209757 |
Predicted MW | 12.4 kDa |
Protein Sequence |
>RC209757 protein sequence
Red=Cloning site Green=Tags(s) MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADL QELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_570133 |
RefSeq Size | 651 |
RefSeq ORF | 333 |
Synonyms | CT12.2; GAGED3; XAGE-2; XAGE2B |
Locus ID | 9502 |
UniProt ID | Q96GT9, A0A024R2A6 |
Cytogenetics | Xp11.22 |
Summary | This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408939 | XAGE2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408939 | Transient overexpression lysate of X antigen family, member 2 (XAGE2) |
USD 436.00 |
|
TP309757 | Recombinant protein of human X antigen family, member 2 (XAGE2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review