C1orf85 (GLMP) (NM_144580) Human Mass Spec Standard

CAT#: PH305863

C1orf85 MS Standard C13 and N15-labeled recombinant protein (NP_653181)

Product Images

Coomassie blue staining of purified GLMP protein (Cat# TP305863). The protein was produced from HEK293T cells transfected with GLMP cDNA clone (Cat# RC205863) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205863
• Predicted MW: 43.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205863 representing NM_144580
  Red=Cloning site Green=Tags(s)
  
  MRGSVECTWGWGHCAPSPLLLWTLLLFAAPFGLLGEKTRQVSLEVIPNWLGPLQNLLHIRAVGTNSTLHY
  VWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAA
  KPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMNDPTRTFANGSLAFRVQAFSRSSRPAQPPRLL
  HTADTCQLEVALIGASPRGNRSLFGLEVATLGQGPDCPSMQEQHSIDDEYAPAVFQLDQLLWGSLPSGFA
  QWRPVAYSQKPGGRESALPCQASPLHPALAYSLPQSPIVRAFFGSQNNFCAFNLTFGASTGPGYWDQHYL
  SWSMLLGVGFPPVDGLSPLVLGIMAVALGAPGLMLLGGGLVLLLHHKKYSEYQSIN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_653181
• RefSeq Size: 1603
• RefSeq ORF: 1218
• Synonyms: C1orf85; NCU-G1
• Locus ID: 112770
• UniProt ID: Q8WWB7
• Cytogenetics: 1q22
• Summary: Required to protect lysosomal transporter MFSD1 from lysosomal proteolysis and for MFSD1 lysosomal localization.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane