FABP6 (NM_001445) Human Mass Spec Standard
CAT#: PH305307
FABP6 MS Standard C13 and N15-labeled recombinant protein (NP_001436)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205307 |
Predicted MW | 14.4 kDa |
Protein Sequence |
>RC205307 protein sequence
Red=Cloning site Green=Tags(s) MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKES NIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001436 |
RefSeq Size | 587 |
RefSeq ORF | 384 |
Synonyms | I-15P; I-BABP; I-BALB; I-BAP; ILBP; ILBP3; ILLBP |
Locus ID | 2172 |
UniProt ID | P51161 |
Cytogenetics | 5q33.3 |
Summary | This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419932 | FABP6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419932 | Transient overexpression lysate of fatty acid binding protein 6, ileal (FABP6), transcript variant 2 |
USD 436.00 |
|
TP305307 | Recombinant protein of human fatty acid binding protein 6, ileal (FABP6), transcript variant 2, 20 µg |
USD 867.00 |
|
TP720196 | Recombinant protein of human fatty acid binding protein 6, ileal (FABP6), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review