CCDC134 (NM_024821) Human Mass Spec Standard
CAT#: PH304377
CCDC134 MS Standard C13 and N15-labeled recombinant protein (NP_079097)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204377 |
Predicted MW | 26.6 kDa |
Protein Sequence |
>RC204377 protein sequence
Red=Cloning site Green=Tags(s) MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVML KGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLI RWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKE EKRKEIRKGPRISRSQSEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079097 |
RefSeq Size | 1279 |
RefSeq ORF | 687 |
Locus ID | 79879 |
UniProt ID | Q9H6E4 |
Cytogenetics | 22q13.2 |
Summary | In extracellular secreted form, promotes proliferation and activation of CD8(+) T cells, suggesting a cytokine-like function (PubMed:25125657). Enhances cytotoxic anti-tumor activity of CD8(+) T cells (PubMed:25125657). May inhibit ERK and JNK signaling activity (PubMed:18087676, PubMed:23070808). May suppress cell migration and invasion activity, via its effects on ERK and JNK signaling (PubMed:23070808).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411042 | CCDC134 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411042 | Transient overexpression lysate of coiled-coil domain containing 134 (CCDC134) |
USD 436.00 |
|
TP304377 | Recombinant protein of human coiled-coil domain containing 134 (CCDC134), 20 µg |
USD 867.00 |
|
TP721226 | Purified recombinant protein of Human coiled-coil domain containing 134 (CCDC134) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review