Neugrin (NGRN) (NM_016645) Human Mass Spec Standard
CAT#: PH303415
NGRN MS Standard C13 and N15-labeled recombinant protein (NP_057729)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203415 |
Predicted MW | 24.2 kDa |
Protein Sequence |
>RC203415 representing NM_016645
Red=Cloning site Green=Tags(s) MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLK KAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNK EIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFD SNGNFLYRI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057729 |
RefSeq Size | 1782 |
RefSeq ORF | 657 |
Synonyms | DSC92; mesenchymal stem cell protein DSC92; neugrin, neurite outgrowth associated; neurite outgrowth associated protein |
Locus ID | 51335 |
UniProt ID | Q9NPE2 |
Cytogenetics | 15q26.1 |
Summary | Plays an essential role in mitochondrial ribosome biogenesis. As a component of a functional protein-RNA module, consisting of RCC1L, NGRN, RPUSD3, RPUSD4, TRUB2, FASTKD2 and 16S mitochondrial ribosomal RNA (16S mt-rRNA), controls 16S mt-rRNA abundance and is required for intra-mitochondrial translation of core subunits of the oxidative phosphorylation system.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413846 | NGRN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422366 | NGRN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413846 | Transient overexpression lysate of neugrin, neurite outgrowth associated (NGRN), transcript variant 1 |
USD 436.00 |
|
LY422366 | Transient overexpression lysate of neugrin, neurite outgrowth associated (NGRN), transcript variant 2 |
USD 436.00 |
|
PH322032 | NGRN MS Standard C13 and N15-labeled recombinant protein (NP_001028260) |
USD 3,255.00 |
|
TP303415 | Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 1, 20 µg |
USD 867.00 |
|
TP322032 | Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review