Neugrin (NGRN) Rabbit Polyclonal Antibody

CAT#: TA344220

Rabbit Polyclonal Anti-NGRN Antibody - N-terminal region

Product Images

WB Suggested Anti-NGRN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NGRN antibody: synthetic peptide directed towards the N terminal of human NGRN. Synthetic peptide located within the following region: MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: neugrin, neurite outgrowth associated
• Database Link:
  NP_001028260
  Entrez Gene 51335 Human
  UniProt ID Q9NPE2
• Background: NGRN may be involved in neuronal differentiation.
• Synonyms: DSC92
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Dog: 79%