Neugrin (NGRN) (NM_001033088) Human Recombinant Protein
CAT#: TP322032
Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222032 representing NM_001033088
Red=Cloning site Green=Tags(s) MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEERELQEVESTLKRQKQAIRFQKIR RQMEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKV LKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGR NKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREF FDSNGNFLYRI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001028260 |
Locus ID | 51335 |
UniProt ID | Q9NPE2 |
Cytogenetics | 15q26.1 |
Refseq Size | 1367 |
Refseq ORF | 873 |
Synonyms | DSC92 |
Summary | Plays an essential role in mitochondrial ribosome biogenesis. As a component of a functional protein-RNA module, consisting of RCC1L, NGRN, RPUSD3, RPUSD4, TRUB2, FASTKD2 and 16S mitochondrial ribosomal RNA (16S mt-rRNA), controls 16S mt-rRNA abundance and is required for intra-mitochondrial translation of core subunits of the oxidative phosphorylation system.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413846 | NGRN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422366 | NGRN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413846 | Transient overexpression lysate of neugrin, neurite outgrowth associated (NGRN), transcript variant 1 |
USD 436.00 |
|
LY422366 | Transient overexpression lysate of neugrin, neurite outgrowth associated (NGRN), transcript variant 2 |
USD 436.00 |
|
PH303415 | NGRN MS Standard C13 and N15-labeled recombinant protein (NP_057729) |
USD 3,255.00 |
|
PH322032 | NGRN MS Standard C13 and N15-labeled recombinant protein (NP_001028260) |
USD 3,255.00 |
|
TP303415 | Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review