Neugrin (NGRN) (NM_001033088) Human Mass Spec Standard

CAT#: PH322032

NGRN MS Standard C13 and N15-labeled recombinant protein (NP_001028260)

Product Images

Coomassie blue staining of purified NGRN protein (Cat# TP322032). The protein was produced from HEK293T cells transfected with NGRN cDNA clone (Cat# RC222032) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222032
• Predicted MW: 32.2 kDa
• Protein Sequence:
  Sequence Link

  >RC222032 representing NM_001033088
  Red=Cloning site Green=Tags(s)
  
  MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEERELQEVESTLKRQKQAIRFQKIR
  RQMEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKV
  LKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGR
  NKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREF
  FDSNGNFLYRI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001028260
• RefSeq Size: 1367
• RefSeq ORF: 873
• Synonyms: DSC92
• Locus ID: 51335
• UniProt ID: Q9NPE2
• Cytogenetics: 15q26.1
• Summary: Plays an essential role in mitochondrial ribosome biogenesis. As a component of a functional protein-RNA module, consisting of RCC1L, NGRN, RPUSD3, RPUSD4, TRUB2, FASTKD2 and 16S mitochondrial ribosomal RNA (16S mt-rRNA), controls 16S mt-rRNA abundance and is required for intra-mitochondrial translation of core subunits of the oxidative phosphorylation system.[UniProtKB/Swiss-Prot Function]