BAP29 (BCAP29) (NM_018844) Human Mass Spec Standard
CAT#: PH303331
BCAP29 MS Standard C13 and N15-labeled recombinant protein (NP_061332)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203331 |
Predicted MW | 28.3 kDa |
Protein Sequence |
>RC203331 protein sequence
Red=Cloning site Green=Tags(s) MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREV RKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQ AENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKM QSERLSKEYDQLLKEHSELQDRLERGNKKRL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061332 |
RefSeq Size | 6034 |
RefSeq ORF | 723 |
Synonyms | BAP29 |
Locus ID | 55973 |
UniProt ID | Q9UHQ4, E9PAJ1 |
Cytogenetics | 7q22.3 |
Summary | May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412884 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423427 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423428 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425235 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412884 | Transient overexpression lysate of B-cell receptor-associated protein 29 (BCAP29), transcript variant 2 |
USD 436.00 |
|
LY423427 | Transient overexpression lysate of B-cell receptor-associated protein 29 (BCAP29), transcript variant 1 |
USD 436.00 |
|
LY423428 | Transient overexpression lysate of B-cell receptor-associated protein 29 (BCAP29), transcript variant 3 |
USD 436.00 |
|
TP303331 | Recombinant protein of human B-cell receptor-associated protein 29 (BCAP29), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review