Wdr61 (NM_001025743) Rat Tagged ORF Clone

CAT#: RR204208

Wdr61 (Myc-DDK-tagged ORF) - Rat WD repeat domain 61 (Wdr61), (10 ug)

Product Images

Circular map for RR204208

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Wdr61
• Synonyms: RGD1308228
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR204208 representing NM_001025743
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACCAACCAGTACAGTATTCTCTTCAAGCAAGAGCAAGCCCACGATGATGCCATATGGTCGGTTGCCT
  GGGAGACAAACAAAAAGGAAAACATTGAAACAGTGGTCACAGGATCCCTGGATGATCTGGTGAAGGTCTG
  GAAATGGCGTGATGAGAGGCTGGAGCTGCAGTGGAGCCTGGAGGGACATCAGCTTGGTGTGGTGTCTGTC
  GACATCAGCCACACCCTTCCCATTGCTGCCTCCAGTTCTCTAGATGCTCATATTCGACTCTGGGACTTGG
  AAAATGGCAAACAGATGAAGTCTATAGATGCAGGACCGGTGGATGCCTGGACTTTGGCATTCTCTCCGGA
  CTCCCAGCATCTGGCAACAGGAACTCACATGGGGAAAGTGAACATTTTTGGTGTGGAAAGTGGAAAAAAA
  GAATACTCTTTGGACACTAGAGGAAAATTCATCCTTAGCATTGCATATAGTCCTGATGGAAAATACCTGG
  CCAGCGGAGCCATAGACGGGATCATCAATATTTTTGATATTGCAACTGGAAAGCTTCTGCACACGCTGGA
  AGGCCATGCGATGCCCATTCGATCCTTGACCTTTTCCCCTGACTCCCAGCTCCTCGTCACGGCTTCAGAT
  GATGGCTACATCAAGATCTATGATGTGCAACATGCCAATTTGGCTGGCACACTGAGTGGCCATGCATCCT
  GGGTATTGAATGTTGCGTTCTGTCCAGATGACACTCACTTTGTTTCCAGTTCATCCGACAAAAGTGTAAA
  GGTCTGGGATGTTGGAACAAGGACCTGTATTCACACCTTCTTTGACCACCAGGATCAGGTTTGGGGAGTA
  AAATATAATGGAAATGGATCAAAAATTGTGTCTGTTGGAGATGACCAGGAGATCCATGTCTATGACTGCC
  CAATT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR204208 representing NM_001025743
  Red=Cloning site Green=Tags(s)
  
  MTNQYSILFKQEQAHDDAIWSVAWETNKKENIETVVTGSLDDLVKVWKWRDERLELQWSLEGHQLGVVSV
  DISHTLPIAASSSLDAHIRLWDLENGKQMKSIDAGPVDAWTLAFSPDSQHLATGTHMGKVNIFGVESGKK
  EYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASD
  DGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDHQDQVWGV
  KYNGNGSKIVSVGDDQEIHVYDCPI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001025743
• ORF Size: 915 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001025743.1, NP_001020914.1
• RefSeq Size: 1232 bp
• RefSeq ORF: 918 bp
• Locus ID: 363064
• UniProt ID: Q4V7A0
• Cytogenetics: 8q24
• MW: 33.7 kDa
• Gene Summary: Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of KMT2A/MLL1. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. Required for mono- and trimethylation on histone H3 'Lys-4' (H3K4me3), dimethylation on histone H3 'Lys-79' (H3K4me3). Required for Hox gene transcription. Component of the SKI complex which is thought to be involved in exosome-mediated RNA decay and associates with transcriptionally active genes in a manner dependent on PAF1C (By similarity).[UniProtKB/Swiss-Prot Function]