FMN1 (NM_001103184) Human Tagged ORF Clone

CAT#: RG216074

FMN1 (GFP-tagged) - Human formin 1 (FMN1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 2,009.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FMN1 (NM_001103184) Human Tagged ORF Clone
Symbol FMN1
Synonyms FMN; LD
Vector pCMV6-AC-GFP
Sequence Data
>RG216074 representing NM_001103184
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAACGTTGATAATTCTCTGGATGGCAGTGATGTGTCAGAACCAGCAAAACCAGAAGCCGGACTTG
AAGTGGCTCAGTCGATCCTGAGTAAGTTCTCTATGAAATCCCTATTTGGGTTTACGAGTAAATTAGAATC
TGTGAATCCAGAAGAGGAAGATGCTGTGCTGAAAGCATTCCATAGTTTAGACGTGAATCCCACATCTCAG
CAGGATGATTCCAGCAATGGCTTGGATCCACAGGAAGCAGGGTCTCGGGTTTCACCTGACCTCGGAAATG
ATGAGAAAATTGCAAGCGTGGAGACAGAATCAGAGGGAAGTCAGAGAAAAGAAGCAGGGACATCTCTCCT
TGCTCAAGAGCTGCTTCCACTGTCTACTTTGAAAGGGACAAAAGACGATGTCATTTGTGTTCGTGGGACC
CTGGTGCACACCACCAGTGATTCTGACTCTGATGATGGTGGCCAGGAGCCAGAGGAGGGAAGCAGCACCA
ATGGCCCAAAGTCCCCTAGTGGTGTTTTATCTGAGCCATCTCAGGAGTCCAAAGAAAACCCAGGAGGTTT
CAGGGAAAATACTGTCACTGGGGAAATGAATGGTGCAGAGCTCTGTGCAGAAGATCCTCAAAGGATTCCA
CCTGAGATGAGCAGCAAACTGGAAGCTGGCAACGGTGGTCTTCAGACAGAGCGTCGCCCCAGCCAGGACC
AGGTGGGAGAAGAAGGGTCCCAAGACCTACCTGCAGTAACAAACCAGAATTCGAGTGTTGGTATCACTGA
GAGTGCCTCTTCTAAAAAAGAAGTCTCTGGAGAGAAGTCATTCCAACTTCCAGCTTTTTTCAGTGGGCTT
CGTGTGCTGAAGAAGGGGGCTACCGCTGAGGGAGGAGAGACCATCACGGAAATTAAACCAAAGGATGGGG
ACTTAGCTTTGCTCAAATTGACGCAGCCTGTGCAGAAGTCCTTAGTGCAGGCAGGGCTGCAGACAGTGAA
GAGTGAGAAGAAAGCAACTGATCCGAAGGCCACTCCCACTCTCCTGGAGCAGCTCTCTCTGCTGCTCAAC
ATTGACATGCCCAAAACTGAACCGAAGGGAGCAGACCCTGAGTCGCCCAGGAGAGAAGAGATGGGCTGCA
ATGCTGACCAAGAGAGCCAGAGCGGCCCTGGAGTACCACAAACCCAGGGTGGTGAGGTCAAGCCAAAGTC
GCCAGAGACAGCCCTGGAGGCTTTTAAAGCCCTATTCATCCGGCCCCCCAGAAAGGGGACCACAGCTGAC
ACCTCTGAGCTGGAAGCTCTCAAGCGCAAGATGAGACATGAGAAGGAGTCGCTAAGAGCTGTGTTTGAAC
GGTCCAATTCTAAGCCAGCGGATGGCCCCTCTGATTCCAAAAGTCCTGACCACAGCCTGACTGAGCAGGA
TGACAGGACTCCTGGCAGACTTCAAGCTGTCTGGCCACCCCCAAAGACAAAAGACACAGAAGAAAAAGTG
GGACTGAAGTACACTGAAGCAGAATACCAAGCTGCTATTTTACACTTGAAGAGGGAGCACAAAGAAGAAA
TTGAAAACCTGCAGGCACAGTTTGAACTTCGGGCATTTCATATCCGGGGCGAGCATGCAATGATAACAGC
GAGACTAGAAGAAACCATTGAAAATCTGAAACACGAGCTAGAACACAGATGGCGAGGGGGTTGTGAAGAG
AGGAAAGATGTGTGCATTTCCACCGATGATGACTGCCCTCCAAAGACCTTCAGAAATGTGTGCGTCCAGA
CAGACAGAGAGACCTTCCTCAAGCCCTGTGAAAGTGAAAGCAAGACAACCAGAAGTAATCAATTAGTACC
CAAAAAGCTGAATATCTCCTCTTTAAGCCAGCTCTCACCCCCAAATGACCACAAAGACATCCATGCAGCA
CTCCAGCCAATGGAGGGCATGGCATCAAATCAGCAGAAGGCATTGCCTCCGCCTCCCGCATCCATCCCTC
CCCCTCCGCCCCTCCCCTCAGGACTTGGATCTTTGTCTCCCGCACCTCCAATGCCACCTGTGAGTGCTGG
GCCACCGCTACCACCTCCGCCTCCTCCACCGCCACCTCTACCTCCACCTTCAAGTGCTGGACCTCCACCA
CCCCCACCCCCACCCCCACTTCCTAACTCCCCTGCCCCACCCAACCCTGGAGGGCCTCCTCCTGCTCCAC
CACCCCCAGGACTTGCACCCCCACCTCCCCCTGGACTCTTCTTTGGACTTGGCTCTTCTTCCAGTCAATG
TCCTCGAAAACCAGCCATCGAGCCCAGTTGTCCCATGAAGCCTTTATATTGGACTAGGATACAAATAAGT
GATAGGAGCCAAAATGCTACACCAACCTTATGGGACTCCTTAGAAGAACCTGACATTCGGGACCCCAGTG
AATTTGAGTATTTATTCTCCAAAGACACAACTCAACAGAAGAAAAAACCTCTGTCAGAGACTTATGAGAA
GAAAAACAAGGTCAAAAAGATCATCAAATTGTTGGATGGAAAACGATCTCAAACTGTGGGAATCTTGATA
TCTAGTTTACATTTAGAAATGAAGGATATCCAACAGGCCATTTTCAATGTGGATGACTCCGTGGTTGATC
TGGAGACCCTGGCAGCCTTATATGAAAACAGAGCCCAAGAGGATGAGCTGGTTAAAATAAGAAAGTATTA
CGAGACATCCAAAGAAGAAGAACTGAAGCTGCTGGATAAACCTGAGCAATTTTTACATGAGTTAGCCCAG
ATTCCTAATTTTGCTGAACGTGCCCAGTGCATAATCTTCAGATCTGTCTTTTCTGAGGGTATCACCTCCT
TGCACAGAAAGGTAGAGATCATCACGCGAGCTTCTAAGGACTTGCTGCACGTGAAGAGCGTGAAGGATAT
TTTAGCTCTCATCTTGGCTTTTGGAAATTATATGAATGGAGGAAATAGGACTCGGGGACAAGCCGATGGA
TATAGCTTAGAAATTCTGCCCAAACTCAAGGATGTCAAAAGTCGGGATAATGGGATTAATCTGGTGGACT
ACGTTGTTAAGTATTACCTGCGTTACTATGATCAGGAAGCTGGAACAGAAAAGAGTGTTTTCCCCTTGCC
GGAACCACAGGATTTCTTTCTGGCCTCCCAAGTCAAGTTTGAAGACCTCATAAAAGATTTGAGAAAACTG
AAGAGGCAACTAGAAGCAAGTGAGAAACAGATGGTGGTGGTGTGCAAGGAGTCCCCAAAGGAGTATCTCC
AGCCTTTCAAGGACAAACTAGAGGAGTTCTTCCAAAAAGCCAAAAAAGAGCATAAGATGGAAGAAAGTCA
CTTGGAGAATGCACAGAAAAGTTTTGAAACAACAGTACGATATTTTGGGATGAAGCCAAAGTCTGGTGAG
AAGGAGATCACACCCAGCTACGTGTTTATGGTGTGGTATGAGTTCTGCAGTGACTTCAAGACAATTTGGA
AACGGGAGAGTAAAAACATATCTAAAGAAAGATTGAAAATGGCTCAGGAATCAGTCAGCAAGTTGACTTC
AGAGAAGAAAGTGGAGACAAAGAAAATCAATCCCACTGCTAGCCTGAAAGAAAGACTGCGTCAGAAGGAA
GCCAGTGTGACCACTAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG216074 representing NM_001103184
Red=Cloning site Green=Tags(s)

MENVDNSLDGSDVSEPAKPEAGLEVAQSILSKFSMKSLFGFTSKLESVNPEEEDAVLKAFHSLDVNPTSQ
QDDSSNGLDPQEAGSRVSPDLGNDEKIASVETESEGSQRKEAGTSLLAQELLPLSTLKGTKDDVICVRGT
LVHTTSDSDSDDGGQEPEEGSSTNGPKSPSGVLSEPSQESKENPGGFRENTVTGEMNGAELCAEDPQRIP
PEMSSKLEAGNGGLQTERRPSQDQVGEEGSQDLPAVTNQNSSVGITESASSKKEVSGEKSFQLPAFFSGL
RVLKKGATAEGGETITEIKPKDGDLALLKLTQPVQKSLVQAGLQTVKSEKKATDPKATPTLLEQLSLLLN
IDMPKTEPKGADPESPRREEMGCNADQESQSGPGVPQTQGGEVKPKSPETALEAFKALFIRPPRKGTTAD
TSELEALKRKMRHEKESLRAVFERSNSKPADGPSDSKSPDHSLTEQDDRTPGRLQAVWPPPKTKDTEEKV
GLKYTEAEYQAAILHLKREHKEEIENLQAQFELRAFHIRGEHAMITARLEETIENLKHELEHRWRGGCEE
RKDVCISTDDDCPPKTFRNVCVQTDRETFLKPCESESKTTRSNQLVPKKLNISSLSQLSPPNDHKDIHAA
LQPMEGMASNQQKALPPPPASIPPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPP
PPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPPGLFFGLGSSSSQCPRKPAIEPSCPMKPLYWTRIQIS
DRSQNATPTLWDSLEEPDIRDPSEFEYLFSKDTTQQKKKPLSETYEKKNKVKKIIKLLDGKRSQTVGILI
SSLHLEMKDIQQAIFNVDDSVVDLETLAALYENRAQEDELVKIRKYYETSKEEELKLLDKPEQFLHELAQ
IPNFAERAQCIIFRSVFSEGITSLHRKVEIITRASKDLLHVKSVKDILALILAFGNYMNGGNRTRGQADG
YSLEILPKLKDVKSRDNGINLVDYVVKYYLRYYDQEAGTEKSVFPLPEPQDFFLASQVKFEDLIKDLRKL
KRQLEASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSFETTVRYFGMKPKSGE
KEITPSYVFMVWYEFCSDFKTIWKRESKNISKERLKMAQESVSKLTSEKKVETKKINPTASLKERLRQKE
ASVTTN

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001103184
ORF Size 3588 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001103184.1, NP_001096654
RefSeq Size 3757
RefSeq ORF 3591
Locus ID 342184
Cytogenetics 15q13.3
Gene Summary This gene belongs to the formin homology family and encodes a protein that has a role in the formation of adherens junction and the polymerization of linear actin cables. The homologous gene in mouse is associated with limb deformity. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)