MAD2L2 (NM_006341) Human Tagged ORF Clone

CAT#: RG203932

  • TrueORF®

MAD2L2 (tGFP-tagged) - Human MAD2 mitotic arrest deficient-like 2 (yeast) (MAD2L2), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_006341" in other vectors (4)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


MAD2B/MAD2L2 Rabbit polyclonal Antibody
    • 100 ul

USD 365.00

Other products for "MAD2L2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol MAD2L2
Synonyms FANCV; MAD2B; POLZ2; REV7
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG203932 representing NM_006341
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCACGCTCACACGACAAGACCTCAACTTTGGCCAAGTGGTGGCCGATGTGCTCTGCGAGTTCCTGG
AGGTGGCTGTGCATCTCATCCTCTACGTGCGCGAGGTCTACCCCGTGGGCATCTTCCAGAAACGCAAGAA
GTACAACGTGCCGGTCCAGATGTCCTGCCACCCGGAGCTGAATCAGTATATCCAGGACACGCTGCACTGC
GTCAAGCCACTCCTGGAGAAGAATGATGTGGAGAAAGTGGTGGTGGTGATTTTGGATAAAGAGCACCGCC
CAGTGGAGAAATTCGTCTTTGAGATCACCCAGCCTCCACTGCTGTCCATCAGCTCAGACTCGCTGTTGTC
TCATGTGGAGCAGCTGCTCCGGGCCTTCATCCTGAAGATCAGCGTGTGCGATGCCGTCCTGGACCACAAC
CCCCCAGGCTGTACCTTCACAGTCCTGGTGCACACGAGAGAAGCCGCCACTCGCAACATGGAGAAGATCC
AGGTCATCAAGGATTTCCCCTGGATCCTGGCGGATGAGCAGGATGTCCACATGCATGACCCCCGGCTGAT
ACCACTAAAAACCATGACGTCGGACATTTTAAAGATGCAGCTTTACGTGGAAGAGCGCGCTCATAAAGGC
AGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203932 representing NM_006341
Red=Cloning site Green=Tags(s)

MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHC
VKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHN
PPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKG
S

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006341
ORF Size 633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006341.4
RefSeq Size 1056 bp
RefSeq ORF 636 bp
Locus ID 10459
UniProt ID Q9UI95
Cytogenetics 1p36.22
Domains HORMA
Protein Families Druggable Genome
Protein Pathways Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation
Gene Summary The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.