FER1L5 (NM_001293083) Human Tagged ORF Clone

CAT#: RC240230

FER1L5 (myc-DDK-tagged) - Human fer-1-like family member 5 (FER1L5)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,968.00


Availability*
7 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FER1L5 (NM_001293083) Human Tagged ORF Clone
Symbol FER1L5
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC240230 representing NM_001293083
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCGGCTTGTGGTGCAGTCGGCCAAGATTGACCCACCACTAGCCCCACTACCCAGGCCCTGCATGT
CCATCGACTTCAGAGATATCAAGAAAAGAACTCGTGTGGTGGAAGGGAATGATCCCGTGTGGAATGAGAC
CCTAATCTGGCACCTCTGGAACCGCCCCCTGGAAAATGACTCCTTCCTGCAAGTCACCCTTCAGGACATG
GGCTCACAAAAGAAAGAAAGATTCATTGGCCTGGCCACAGTACTGCTCAAGCCATTGTTGAAACAACCAA
GTGAGGTCCTTTTTGTGAAGGACTTGACCCTGCTCAACCATTCCATGAAGCCCACAGATTGTACTGTCAC
CCTACAGGTGGCCCACATGAGCAACCAGGATATTGAGAAGACAGGAGCTGAAGACCACCTGGGCATAACG
GCAAGAGAGGCAGCCAGTCAGAAACTGATGGTCCCTGGCTCCACTGCGCACAGGGCTCTGTCCTCAAAGC
CTCAGCACTTTCAGGTTCGAGTGAAGGTGTTTGAAGCCCGACAGCTCATGGGCAACAACATCAAACCAGT
GGTGAAGGTGTCCATCGCAGGCCAGCAGCACCAGACACGCATCAAGATGGGAAACAACCCTTTCTTTAAT
GAGATCTTCTTCCAGAATTTTCATGAGGTTCCTGCAAAGTTCTTTGATGAGACCATCTTAATCCAGGTGG
TGAACTCCTCAGCAATGAGATACAAAGCAGAGATCGGGAGATTTCAAACAGATATTGGGTTTATCTACCA
TTCTCCAGGTCACACACTCCTAAGGAAATGGCTAGGCCTCTGCCAGCCAAATAACCCTGGCAGTGGTGTG
ACAGGCTACCTGAAAGTCACCATCTATGCCCTCGGTGTGGGAGACCAGGCCCTGATAGATCAAAAGCTGC
TCTATGGCACCGATGACACCGATATTCAGATCTTCAAGTCAGCGGTAGTCCCGATCAACATGGCTTACTT
ACAGCTCTTCATCTACTGCGCAGAGGACCTTCACCTCAAGAAACACCAGTCAGTGAATCCTCAGTTGGAG
GTGGAACTAATTGGGGAAAAGCTCAGGACACACATGCAGACCCAAACCGACAACCCGATATGGAACCAGA
TCCTGACCTTCCGGATTCAGCTACCCTGCCTCTCCAGCTACATCAAGTTCAGAGTCTTGGACTGCCGCAA
GAAGGACTGCCCGGATGAGATTGGGACTGCCAGCCTGTCCCTCAACCAGATCTCGTCCACCGGAGAAGAG
ATAGAAGGAGTGTACTCCGGCTTCCTGCCCTGCTTTGGCCCCAGCTTCCTGACTCTGCATGGGGGTAAAA
AGGCCCCTTTCAGGATCCAGGAAGAAGGCGCTTGTATTCCCGACTCTGTTAGGGATGGTTTAGCTTATCG
AGGCCGAGTCTTCCTGGAGTTAATCACCCAAATCAAGTCCTATCAAGACTCCACGATAAAGGATCTCTCC
CATGAAGTGACCAGGATAGAGAAGCACCAGAACCGCCAAAAGTATGGGCTGTGCGTCATCTTCCTTTCCT
GTACCATGATGCCCAACTTTAAAGAGCTGATCCATTTCGAGGTCAGCATCGGTCACTATGGGAACAAGAT
GGACCTGAATTACAAGCCTCTAGTCTCAAGCACACCGTACAGCCCAGTGATATATGATGGGAACATCTAC
CATTATGTGCCCTGGTACAACACCAAGCCTGTCGTGGCCGTGACCTCCAACTGGGAGGACGTCAGCTTCC
GCATGAACTGCCTCAACCTCCTCCACTTCACTCGGGACCGCCTGAAAGCCAACCTGGACACCCTGAAATC
CACGCGGAATCCGAAGGATCCAGCTCTCCTCTACCAGTGGGAGAAACTGCTGAGGGAGCTGGCAGAGGAC
TGCAAGCGCCCTCTGCCCTGCATGACCTATCAGCCCAAAGCCACCAGCCTGGACAGGAAGAGGTGGCAGC
TCCGCAGCCTCCTCCTGCAGGAACTGGCCCAAAAGGCCAAGCAAGCCAAGCCCAAGGACATGGTGGCCAC
AGCGGAGGACTGGCTGTACCGCCTCAACACCGTGCTCCCTGAGCCCCAGATGGGCCTCCCTGACGTGATG
ATTTGGCTGGTGGCCAAGGAGCAGCGAGTGGCCTATGCACAGGTGCCTGCCCACTCCGTCCTCTTCTCCC
CGGCAGGGGCTCTGCACTCCGGCAGGCTCTGTGGGAAGATACAGACACTCTTCCTACAGTACCCAGAGGG
TGAAGGACAGAAGGATGTGCTCCCAGCTCACCTCCGGGTCTGCATGTGGCTTGGCAATGTCACAGACAGC
AAGGACCTGCAGCTGCTCCGCCAGGGTGACACAGCGGTGTACGCCGAGATGTATGAGAATCAGGCCAAGT
ATAAAGACCAGTGGGGGCAGCAGGGGCTGTATCACTGCCCCAACTTCTCGGATGTCATGGGGAACAAGAC
CCTCCCCATGACGGATTTCCAACCACCCCTGGGATGGCACTGGCAGGACAGCTGGACAGTGGAACCTCAG
AGAAGGCTCCTCCTGGACATAGACATCAACAAGAGCCAGGTGCTGGAGGAGGTATATGAGAACCAGGGCC
GTGACACCAGAGGGGCCTGGGGGCCTGCCGCCATCCCAAACACAGACGTGAATGGACAGCCCATGGAGGC
CCGGGAGAACGTGAAGTGCCCCCAAGGCTGGCACTTTAAGAAGGACTGGGTGGTGGAGCTGAACCACGCA
GTGGACAGTAAGGGCTGGGAGTATGGAGTGGGGATCCCACCGTCGGGCCTGCCCCAGGTCTGGAGCCCGG
TGGAGAAGACCTACCACTCGTGCCGCCGCCGGCGCTGGGCGCGTGTGCGCTTCAGGAACCATGGGGAGCT
GAGCCACGAGCAGGAGACCCTCTCCTTCCTGCAGCTGGGCCTGGCCAAGGGCGAGGAGGAGGGCTGGGAG
TATGACACCTTCGGCTCCAAGTTCCACCTCAACCCTCAGCCCCAGAGCCGGTTCCGCCGCCGCTGCTGGC
GCCGCAGGCTGGCCCCCAACAAGGACAAGGGCATCGCGCCCATATTCCTCCTGGAGGGGTCCTTGGCTAT
GGATCTGAAATACCACGCTGGGAAGGAAGAGGACAGCAAGACATGGCCATGGGGTCTGGACAGACAGTTC
AGGGACCCCCAGAGGCAGGACACCCGGCCCCCCAACTTGCCCTTCATCTACTGCACCTTCAATAAGCCCC
ACTACTACCAGCTCTTCTGCTACATCTACCAGGCCCGGAACCTGGTGTCCAATCAGATCCTGACATTCCA
AGGGCCCTTCATTCGGGTGGTCTTCCTGAACCACAGCCAGTGCACCCAAACCCTGAGGAGCTCTGCAGGC
CCCACATGGGCCCAGACACTCATCTTCCAGCACCTCCTTCTGTACGAGAACCCACAGGACACCAAAGAGA
GCCCACCGCTTGTGGTGCTGGAGCTGTGGCAGCGTGACTTCTGGGGCAAGGAGAGCTTGTGGGGACGGAG
CGTGTGGCCCCCAATGGTCTGGCTGGATCTCCAGGACCGGATCCTGCCCCCCATGAGGTGGCATCCCCTT
GTAAAGGAGTTGGGGAAGGAAGAGGGCGAGATCTTGGCATCCTGTGAGCTGATCCTCCAGACTGAGAAGC
TTGGAGAGAAGCAGCTGCCTATCTTAAGCGTTCCCTGGAAGAATGGGGCATACACACTCCCCAAGAGCAT
CCAGCCCACGATAAAGAGGATGGCCATTGAGATCCTGGCCTGGGGCCTTCGGAACATGAAGAAGGCGAGC
TCCCCCCAGCTCCTGGTGGAATTCGGGGAAGAGTCCCTGAGGACAGAACCCATCAGGGACTTTCAGACCA
ACCCCAACTTCCCCGAGTCTGAGTCTGTCCTAGTCCTCACAGTGCTCATGCCGACGGAGGAGGCCTATGC
ACTGCCCCTCGTGGTGAAGGTGGTAGACAACTGGGCCTTCGGCCAGCAGACCGTGACGGGCCAGGCCAAC
ATCGACTTCCTCCAGCCCTACTTCTGTGACCCCTGGGCTCAAGACTATATGCACCCAAAGCTTCCAACGC
TGTCTGAGAAGAAGCACCAAGACTTCCTAGGCTACCTCTACAGAAAGTTCTGGTTCAAGTCCAGTAAAGC
AGAGGATGAGTATGAGCATGAGGTGGACTGGTGGAGCAAGCTGTTCTGGGCCACAGATGAGCACAAGTCC
CTGAAGTACAAGTACAAAGACTACCACACCCTCAAGGTGTATGAGTGTGAGCTGGAGGCCGTGCCAGCCT
TCCAGGGCCTGCAGGACTTCTGCCAGACCTTCAAACTCTACCAGGAGCAGCCCAAGTTGGACAGCCCCGT
GGTAGGGGAGTTCAAGGGCCTTTTCCGCATCTACCCCTTTCCTGAGAATCCAGAAGCCCCAAAGCCCCCG
CTGCAGTTCTTGGTTTGGCCAGAGAGAGAGGACTTCCCCCAGCCGTGCTTGGTGCGGGTGTACATGGTAC
GAGCCATCAACCTGCAGCCCCAGGACTACAATGGCCTGTGTGACCCTTATGTGATCCTGAAACTGGGCAA
GACAGAGCTTGGCAACCGGGACATGTACCAGCCCAACACTCTGGATCCCATCTTTGGCATGATGTTTGAA
CTCACCTGCAACATACCCCTGGAGAAGGACCTAGAGATCCAGCTCTATGACTTCGACCTATTTTCACCTG
ATGATAAGATAGGAACCACAGTCATCGACCTTGAAAACCGACTCCTATCTGGCTTTGGAGCTCATTGTGG
GCTCTCCAAATCCTACTGCCAGTCAGGGCCCTTTAGATGGCGGGATCAGATGCCCCCAAGCTACCTCCTA
GAACGCTATGCCAAGCGGAAAGGGCTACCTCCGCCTCTGTTCAGTCCTGAGGAAGATGCTGTTTTCTATA
ATGGGAAAAAGTTCAAGCTGCAAAGCTTTGAGCCCAAAACCCCTACTGTTCATGGTTTGGGACCCAAGAA
GGAACGCCTTGCACTGTACCTCCTGCACACCCAGGGGCTGGTACCTGAGCACGTGGAGACCCGCACACTG
TACAGCCACAGCCAGCCAGGCATCGACCAGGGAAAGGTGCAAATGTGGGTGGACATCTTCCCCAAGAAGC
TGGGGCCTCCTGGCCCCCAAGTCAACATCAACCCCAGAAAGCCTAAACGGTATGAGCTGCGATGCATCAT
CTGGAAGACTGCCAATGTGGACCTGGTGGATGACAATTTAAGTAGAGAGAAGACGAGCGACATCTACATC
AAAGGGTGGTTATACGGGCTGGAGAAGGACATGCAGAAGACAGACATCCACTACCACTCGCTGACTGGGG
AGGCCGACTTCAACTGGCGGTTCATCTTTACCATGGACTACCTGGCGGCGGAGCGCACGTGTGTCCAGAG
CCAGAAGGATTACATATGGAGCCTGGATGCCACGTCCATGAAGTTCCCAGCCCGACTTATCATCCAGGTC
TGGGACAATGACATCTTCTCCCCCGACGACTTCCTAGGGGTCCTGGAGCTGGATTTGTCTGACATGCCCC
TCCCGGCTCGGCACGCCAAGCAGTGCTCCATCAGGATGATGGACGCCGACCCCAAGTGGCCCTATTTCAT
CCAATACAAGCACTTCTCCCTCTTTAAGAAGAAGACTGTGACTGGCTGGTGGCCTTGCCAGGTCCTCGAT
GGTGGCAAATGGCGCTTGTCGGGCAAGGTGAAGATGAGCCTGGAGATTCTGTCAGAGAAGGAAGCCTTAA
TCAAGCCAGCCGGGCGAGGCCAGTCGGAACCCAACCAGTACCCCACACTTCATCCTCCCCTACGCACCAA
CACCTCTTTCACGTGGCTGCGGTCACCAGTTCAAAACTTCTGCTATATTTTCTGGAAACGCTATCGCTTC
AAACTCATAGCCTTTATGGTCATATCGATTATAGCACTTATGCTGTTTAACTTCATCTATTCAGCTCCGC
ACTATTTGGCCATGAGCTGGATCAAACCTCAACTTCAGCTGTATCCTCCCATTAAAATATTCAATATCAT
CAATTCACTAAACACCAGCAACGCCAGCTCTTCCATCCTTCCCACCCAGGATCCAAACCTAAAGCCTACA
ATAGACCATGAGTGGAAACTCCACCCAGGACCCACAAATCACCTGAGTGATATTTTCCCAGAACTTCCAG
CCCCAGGAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC240230 representing NM_001293083
Red=Cloning site Green=Tags(s)

MLRLVVQSAKIDPPLAPLPRPCMSIDFRDIKKRTRVVEGNDPVWNETLIWHLWNRPLENDSFLQVTLQDM
GSQKKERFIGLATVLLKPLLKQPSEVLFVKDLTLLNHSMKPTDCTVTLQVAHMSNQDIEKTGAEDHLGIT
AREAASQKLMVPGSTAHRALSSKPQHFQVRVKVFEARQLMGNNIKPVVKVSIAGQQHQTRIKMGNNPFFN
EIFFQNFHEVPAKFFDETILIQVVNSSAMRYKAEIGRFQTDIGFIYHSPGHTLLRKWLGLCQPNNPGSGV
TGYLKVTIYALGVGDQALIDQKLLYGTDDTDIQIFKSAVVPINMAYLQLFIYCAEDLHLKKHQSVNPQLE
VELIGEKLRTHMQTQTDNPIWNQILTFRIQLPCLSSYIKFRVLDCRKKDCPDEIGTASLSLNQISSTGEE
IEGVYSGFLPCFGPSFLTLHGGKKAPFRIQEEGACIPDSVRDGLAYRGRVFLELITQIKSYQDSTIKDLS
HEVTRIEKHQNRQKYGLCVIFLSCTMMPNFKELIHFEVSIGHYGNKMDLNYKPLVSSTPYSPVIYDGNIY
HYVPWYNTKPVVAVTSNWEDVSFRMNCLNLLHFTRDRLKANLDTLKSTRNPKDPALLYQWEKLLRELAED
CKRPLPCMTYQPKATSLDRKRWQLRSLLLQELAQKAKQAKPKDMVATAEDWLYRLNTVLPEPQMGLPDVM
IWLVAKEQRVAYAQVPAHSVLFSPAGALHSGRLCGKIQTLFLQYPEGEGQKDVLPAHLRVCMWLGNVTDS
KDLQLLRQGDTAVYAEMYENQAKYKDQWGQQGLYHCPNFSDVMGNKTLPMTDFQPPLGWHWQDSWTVEPQ
RRLLLDIDINKSQVLEEVYENQGRDTRGAWGPAAIPNTDVNGQPMEARENVKCPQGWHFKKDWVVELNHA
VDSKGWEYGVGIPPSGLPQVWSPVEKTYHSCRRRRWARVRFRNHGELSHEQETLSFLQLGLAKGEEEGWE
YDTFGSKFHLNPQPQSRFRRRCWRRRLAPNKDKGIAPIFLLEGSLAMDLKYHAGKEEDSKTWPWGLDRQF
RDPQRQDTRPPNLPFIYCTFNKPHYYQLFCYIYQARNLVSNQILTFQGPFIRVVFLNHSQCTQTLRSSAG
PTWAQTLIFQHLLLYENPQDTKESPPLVVLELWQRDFWGKESLWGRSVWPPMVWLDLQDRILPPMRWHPL
VKELGKEEGEILASCELILQTEKLGEKQLPILSVPWKNGAYTLPKSIQPTIKRMAIEILAWGLRNMKKAS
SPQLLVEFGEESLRTEPIRDFQTNPNFPESESVLVLTVLMPTEEAYALPLVVKVVDNWAFGQQTVTGQAN
IDFLQPYFCDPWAQDYMHPKLPTLSEKKHQDFLGYLYRKFWFKSSKAEDEYEHEVDWWSKLFWATDEHKS
LKYKYKDYHTLKVYECELEAVPAFQGLQDFCQTFKLYQEQPKLDSPVVGEFKGLFRIYPFPENPEAPKPP
LQFLVWPEREDFPQPCLVRVYMVRAINLQPQDYNGLCDPYVILKLGKTELGNRDMYQPNTLDPIFGMMFE
LTCNIPLEKDLEIQLYDFDLFSPDDKIGTTVIDLENRLLSGFGAHCGLSKSYCQSGPFRWRDQMPPSYLL
ERYAKRKGLPPPLFSPEEDAVFYNGKKFKLQSFEPKTPTVHGLGPKKERLALYLLHTQGLVPEHVETRTL
YSHSQPGIDQGKVQMWVDIFPKKLGPPGPQVNINPRKPKRYELRCIIWKTANVDLVDDNLSREKTSDIYI
KGWLYGLEKDMQKTDIHYHSLTGEADFNWRFIFTMDYLAAERTCVQSQKDYIWSLDATSMKFPARLIIQV
WDNDIFSPDDFLGVLELDLSDMPLPARHAKQCSIRMMDADPKWPYFIQYKHFSLFKKKTVTGWWPCQVLD
GGKWRLSGKVKMSLEILSEKEALIKPAGRGQSEPNQYPTLHPPLRTNTSFTWLRSPVQNFCYIFWKRYRF
KLIAFMVISIIALMLFNFIYSAPHYLAMSWIKPQLQLYPPIKIFNIINSLNTSNASSSILPTQDPNLKPT
IDHEWKLHPGPTNHLSDIFPELPAPGD

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001293083
ORF Size 6171 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001293083.1, NP_001280012
RefSeq Size 6497
RefSeq ORF 6174
Locus ID 90342
Cytogenetics 2q11.2
Protein Families Transmembrane
MW 238.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)