RFC2 (NM_001278793) Human Tagged ORF Clone

CAT#: RC236660

RFC2 (myc-DDK-tagged) - Human replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 5

Product Images

Circular map for RC236660

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RFC2
• Synonyms: RFC40
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC236660 representing NM_001278793
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTTGGAACTCAATGCTTCAAATGACAGCATGACCGACGGAGCCCAGCAAGCCTTGAGGAGAACCATGG
  AAATCTACTCTAAAACCACTCGCTTCGCCCTTGCTTGTAATGCTTCGGATAAGATCATCGAGCCCATTCA
  GTCCCGCTGTGCAGTCCTCCGGTACACAAAGCTGACCGACGCCCAGATCCTCACCAGGCTGATGAATGTT
  ATCGAGAAGGAGAGGGTACCCTACACTGATGACGGCCTAGAAGCCATCATCTTCACGGCCCAGGGAGACA
  TGAGGCAGGCGCTGAACAACCTGCAGTCCACCTTCTCAGGATTTGGCTTCATTAACAGTGAGAACGTGTT
  CAAGGTCTGTGACGAGCCCCACCCACTGCTGGTAAAGGAGATGATCCAGCACTGTGTGAATGCCAACATT
  GACGAAGCCTACAAGATTCTTGCTCACTTGTGGCATCTGGGCTACTCACCAGAAGATATCATTGGCAACA
  TCTTTCGAGTGTGTAAAACTTTCCAAATGGCAGAATACCTGAAACTGGAGTTTATCAAGGAAATTGGATA
  CACTCACATGAAAATAGCGGAAGGAGTGAACTCTCTTTTGCAGATGGCAGGCCTCCTGGCAAGGCTGTGT
  CAGAAGACAATGGCCCCGGTGGCCAGT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC236660 representing NM_001278793
  Red=Cloning site Green=Tags(s)
  
  MLELNASNDSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRLMNV
  IEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFGFINSENVFKVCDEPHPLLVKEMIQHCVNANI
  DEAYKILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLC
  QKTMAPVAS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001278793
• ORF Size: 657 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001278793.1, NP_001265722.1
• RefSeq Size: 1759 bp
• RefSeq ORF: 660 bp
• Locus ID: 5982
• UniProt ID: P35250
• Cytogenetics: 7q11.23
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: DNA replication, Mismatch repair, Nucleotide excision repair
• MW: 25.2 kDa
• Gene Summary: This gene encodes a member of the activator 1 small subunits family. The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). Replication factor C, also called activator 1, is a protein complex consisting of five distinct subunits. This gene encodes the 40 kD subunit, which has been shown to be responsible for binding ATP and may help promote cell survival. Disruption of this gene is associated with Williams syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene of this gene has been defined on chromosome 2. [provided by RefSeq, Jul 2013]