TIPIN (NM_001289986) Human Tagged ORF Clone

CAT#: RC236515

TIPIN (myc-DDK-tagged) - Human TIMELESS interacting protein (TIPIN), transcript variant 2

Product Images

Circular map for RC236515

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: TIPIN
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC236515 representing NM_001289986
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCTAATCAGACACATGGAGCACTGGGCACATAGGCTATTCCCTAAACTGCAGTTTGAGGATTTTATTG
  ACAGAGTTGAATACCTGGGAAGTAAAAAGGAAGTTCAGACCTGTTTAAAACGAATTCGACTTGATCTCCC
  TATTTTACATGAAGATTTTGTTAGCAATAATGATGAAGTTGCGGAGAATAATGAACATGATGTCACTTCT
  ACTGAATTAGATCCCTTTCTGACAAACTTATCTGAAAGTGAGATGTTTGCTTCTGAGTTAAGTAGAAGCC
  TAACAGAAGAGCAACAACAAAGAATTGAGAGAAATAAACAACTGGCCTTGGAAAGAAGGCAGGCAAAGCT
  GCTGAGTAATAGTCAGACCCTAGGAAATGATATGTTAATGAATACACCCAGGGCACACACGGTTGAAGAG
  GTTAATACTGATGAGGATCAAAAGGAGGAGTCAAATGGATTAAACGAAGACATTCTGGACAATCCATGTA
  ATGATGCTATTGCCAATACTTTAAATGAAGAGGAAACACTGCTGGACCAGTCTTTTAAAAATGTGCAACA
  GCAACTTGATGCTACATCCAGAAATATTACTGAAGCTAGA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC236515 representing NM_001289986
  Red=Cloning site Green=Tags(s)
  
  MLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTS
  TELDPFLTNLSESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEE
  VNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLDQSFKNVQQQLDATSRNITEAR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001289986
• ORF Size: 600 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001289986.1, NP_001276915.1
• RefSeq Size: 1219 bp
• RefSeq ORF: 603 bp
• Locus ID: 54962
• UniProt ID: Q9BVW5
• Cytogenetics: 15q22.31
• Protein Families: Druggable Genome
• MW: 23.7 kDa
• Gene Summary: The protein encoded by this gene is part of the replisome complex, a group of proteins that support DNA replication. It binds TIM, which is involved in circadian rhythm regulation, and aids in protecting cells against DNA damage and stress. Two pseudogenes and two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]