LIAS (NM_001278591) Human Tagged ORF Clone

CAT#: RC235999

  • TrueORF®

LIAS (myc-DDK-tagged) - Human lipoic acid synthetase (LIAS), transcript variant 4

ORF Plasmid: DDK tGFP


  "NM_001278591" in other vectors (2)

Reconstitution Protocol

USD 165.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-LIAS Antibody
    • 100 ul

USD 539.00

Other products for "LIAS"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LIAS
Synonyms HGCLAS; HUSSY-01; LAS; LIP1; LS; PDHLD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC235999 representing NM_001278591
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCTACGCTGCGGGGATGCAGCCCGCACCCTGGGGCCCCGGGTATTTGGGAGATATTTTTGCAGCC
CAGTCAGACCGTTAAGCTCCTTGCCAGATAAAAAAAAGGAACTCCTACAGAATGGACCAGACCTTCAAGA
TTTTGTATCTGGTGATCTTGCAGACAGGAGCACCTGGGATGAATATAAAGGAAACCTAAAACGCCAGAAA
GGAGAAAGGTTAAGACTACCTCCATGGCTAAAGACAGAGATTCCCATGGGGAAAAATTACAATAAACTGA
AAAATACTTTGCGGAATTTAAATCTCCATACAGTATGTGAGGAAGCTCGATGTCCCAATATTGGAGAGTG
TTGGGGAGGTGGAGAATATGCCACCGCCACAGCCACGATCATGGTAGGGCCAGCCTCAACCTCTATGGCT
TTAGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC235999 representing NM_001278591
Red=Cloning site Green=Tags(s)

MSLRCGDAARTLGPRVFGRYFCSPVRPLSSLPDKKKELLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQK
GERLRLPPWLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMVGPASTSMA
LV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001278591
ORF Size 426 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001278591.1, NP_001265520.1
RefSeq Size 702 bp
RefSeq ORF 429 bp
Locus ID 11019
UniProt ID O43766
Cytogenetics 4p14
Protein Pathways Lipoic acid metabolism, Metabolic pathways
MW 16.3 kDa
Gene Summary The protein encoded by this gene belongs to the biotin and lipoic acid synthetases family. Localized in the mitochondrion, this iron-sulfur enzyme catalyzes the final step in the de novo pathway for the biosynthesis of lipoic acid, a potent antioxidant. The deficient expression of this enzyme has been linked to conditions such as diabetes, atherosclerosis and neonatal-onset epilepsy. Alternative splicing occurs at this locus, and several transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Aug 2020]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.