GDAP1L1 (NM_001256738) Human Tagged ORF Clone

CAT#: RC232362

  • TrueORF®

GDAP1L1 (Myc-DDK tagged) - Homo sapiens ganglioside induced differentiation associated protein 1-like 1 (GDAP1L1), transcript variant 3

ORF Plasmid: DDK tGFP


  "NM_001256738" in other vectors (2)

Reconstitution Protocol

USD 330.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


GDAP1L1 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
    • 100 ul

USD 447.00

Other products for "GDAP1L1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GDAP1L1
Synonyms dJ881L22.1; dJ995J12.1.1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC232362 representing NM_001256738
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCTCAACCTGGGCGAGGAGGTGCCCGTCATCATCCACCGCGACAACATCATCAGTGACTATGACC
AGATCATTGACTATGTGGAGCGCACCTTCACAGGAGAGCACGTGGTGGCCCTGATGCCCGAGGTGGGCAG
CCTGCAGCACGCACGGGTGCTGCAGTACCGGGAGCTGCTGGACGCACTGCCCATGGATGCCTACACGCAT
GGCTGCATCCTGCATCCCGAGCTCACCACCGACTCCATGATCCCCAAGTACGCCACGGCCGAGATCCGCA
GACATTTAGCCAATGCCACCACGGACCTCATGAAACTGGACCATGAAGAGGAGCCCCAGCTCTCCGAGCC
CTACCTTTCTAAACAAAAGAAGCTCATGGCCAAGATCTTGGAGCATGATGATGTGAGCTACCTGAAGAAG
ATCCTCGGGGAACTGGCCATGGTGCTGGACCAGATTGAGGCGGAGCTGGAGAAGAGGAAGCTGGAGAACG
AGGGGCAGAAATGCGAGCTGTGGCTCTGTGGCTGTGCCTTCACCCTCGCTGATGTCCTCCTGGGAGCCAC
CCTGCACCGCCTCAAGTTCCTGGGACTGTCCAAGAAATACTGGGAAGATGGCAGCCGGCCCAACCTGCAG
TCCTTCTTTGAGAGGGTCCAGAGACGCTTTGCCTTCCGGAAAGTCCTGGGTGACATCCACACCACCCTGC
TGTCGGCCGTCATCCCCAATGCTTTCCGGCTGGTCAAGAGGAAACCCCCATCCTTCTTCGGGGCGTCCTT
CCTCATGGGCTCCCTGGGTGGGATGGGCTACTTTGCCTACTGGTACCTCAAGAAAAAATACATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC232362 representing NM_001256738
Red=Cloning site Green=Tags(s)

MRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHARVLQYRELLDALPMDAYTH
GCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKK
ILGELAMVLDQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQ
SFFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFAYWYLKKKYI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001256738
ORF Size 834 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001256738.1, NP_001243667.1
RefSeq Size 2645 bp
RefSeq ORF 837 bp
Locus ID 78997
UniProt ID Q96MZ0
Cytogenetics 20q13.12
Protein Families Transmembrane
MW 32.5 kDa
Gene Summary The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. The protein encoded by this gene is similar in sequence to the human GDAP1 protein. Several transcript variants encoding different isoforms, as well as a noncoding transcript variant, have been found for this gene. [provided by RefSeq, Feb 2012]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.