ZIC4 (NM_001243256) Human Tagged ORF Clone

CAT#: RC231739

  • TrueORF®

ZIC4 (Myc-DDK tagged) - Homo sapiens Zic family member 4 (ZIC4), transcript variant 6

ORF Plasmid: DDK tGFP


  "NM_001243256" in other vectors (2)

Reconstitution Protocol

USD 165.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Antibody against ZIC4 (C-term)
    • 400 ul

USD 580.00

Other products for "ZIC4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZIC4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC231739 representing NM_001243256
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGATACAAGACATCCTTGGTGATGAGGAAACGATTACGGCTTTACCGAAACACTCTTAAAGAGTCAA
GCGAGAAGCCCTTCAGATGCGAGTTCGAGGGCTGCGAGCGGCGCTTCGCCAACAGCAGCGACCGTAAGAA
GCATTCGCACGTGCACACTAGCGACAAGCCATACACGTGCAAGGTGCGGGGCTGCGACAAGTGCTACACG
CACCCCAGCTCGCTGCGTAAGCACATGAAGGTGCACGGGCGCTCGCCGCCGCCCAGCTCTGGCTACGATT
CGGCTACACCGTCTGCCCTCGTGTCGCCCTCGTCGGACTGCGGCCACAAGTCCCAGGTGGCCTCCTCGGC
GGCGGTGGCGGCGCGTACCGCCGACTTGAGCGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC231739 representing NM_001243256
Red=Cloning site Green=Tags(s)

MRYKTSLVMRKRLRLYRNTLKESSEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYT
HPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQVASSAAVAARTADLSE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001243256
ORF Size 384 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001243256.1, NP_001230185.1
RefSeq Size 3660 bp
RefSeq ORF 387 bp
Locus ID 84107
UniProt ID Q8N9L1
Cytogenetics 3q24
MW 14.8 kDa
Gene Summary This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. Heterozygous deletion of these linked genes is involved in Dandy-Walker malformation, which is a congenital cerebellar malformation. Multiple transcript variants have been identified for this gene. [provided by RefSeq, Dec 2009]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.