TIMM8B (NM_012459) Human Tagged ORF Clone
CAT#: RC229090
TIMM8B (Myc-DDK-tagged)-Human translocase of inner mitochondrial membrane 8 homolog B (yeast) (TIMM8B), nuclear gene encoding mitochondrial protein, transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_012459" in other vectors (5)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | TIMM8B |
Synonyms | DDP2; TIM8B |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC229090 representing NM_012459
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCGCAAACACAGCTGTCGGAAGGTGGCGAGCCTGAGGCGAACAATGGCGGAGCTGGGCGAAGCCGATG AAGCGGAGTTGCAGCGCCTGGTGGCCGCCGAGCAGCAGAAGGCGCAGTTTACTGCACAGGTGCATCACTT CATGGAGTTATGTTGGGATAAATGTGTGGAGAAGCCAGGGAATCGCCTAGACTCTCGCACTGAAAATTGT CTCTCCAGCTGTGTAGACCGCTTCATTGACACCACTCTTGCCATCACCAGTCGGTTTGCCCAGATTGTAC AGAAAGGAGGGCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC229090 representing NM_012459
Red=Cloning site Green=Tags(s) MRKHSCRKVASLRRTMAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENC LSSCVDRFIDTTLAITSRFAQIVQKGGQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_012459 |
ORF Size | 294 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_012459.2, NP_036591.2 |
RefSeq ORF | 252 bp |
Locus ID | 26521 |
UniProt ID | Q9Y5J9 |
Cytogenetics | 11q23.1 |
Domains | zf-Tim10_DDP |
MW | 11 kDa |
Gene Summary | This gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma.[provided by RefSeq, Aug 2009] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC229090L3 | Lenti ORF clone of Human translocase of inner mitochondrial membrane 8 homolog B (yeast) (TIMM8B), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC229090L4 | Lenti ORF clone of Human translocase of inner mitochondrial membrane 8 homolog B (yeast) (TIMM8B), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged |
USD 450.00 |
|
RG229090 | TIMM8B (tGFP-tagged) - Human translocase of inner mitochondrial membrane 8 homolog B (yeast) (TIMM8B), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 350.00 |
|
SC115362 | TIMM8B (untagged)-Human translocase of inner mitochondrial membrane 8 homolog B (yeast) (TIMM8B), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 150.00 |
|
SC327725 | TIMM8B (untagged)-Human translocase of inner mitochondrial membrane 8 homolog B (yeast) (TIMM8B) nuclear gene encoding mitochondrial protein transcript variant 1 |
USD 165.00 |
{0} Product Review(s)
Be the first one to submit a review