Calcitonin receptor(CALCR) (NM_001164737) Human Tagged ORF Clone

CAT#: RC228419

CALCR (Myc-DDK-tagged)-Human calcitonin receptor (CALCR), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 649.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Calcitonin receptor(CALCR) (NM_001164737) Human Tagged ORF Clone
Symbol CALCR
Synonyms CRT; CT-R; CTR; CTR1
Vector pCMV6-Entry
Sequence Data
>RC228419 representing NM_001164737
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAATTTTCTGGAGAGAAGATTAGTGGACAAAGAGATCTTCAAAAATCAAAAATGAGGTTCACATTTA
CAAGCCGGTGCTTGGCACTGTTTCTTCTTCTAAATCACCCAACCCCAATTCTTCCTGCCTTTTCAAATCA
AACCTATCCAACAATAGAGCCCAAGCCATTTCTTTACGTCGTAGGACGAAAGAAGATGATGGATGCACAG
TACAAATGCTATGACCGAATGCAGCAGTTACCCGCATACCAAGGAGAAGGTCCATATTGCAATCGCACCT
GGGATGGATGGCTGTGCTGGGATGACACACCGGCTGGAGTATTGTCCTATCAGTTCTGCCCAGATTATTT
TCCGGATTTTGATCCATCAGAAAAGGTTACAAAATACTGTGATGAAAAAGGTGTTTGGTTTAAACATCCT
GAAAACAATCGAACCTGGTCCAACTATACTATGTGCAATGCTTTCACTCCTGAGAAACTGAAGAATGCAT
ATGTTCTGTACTATTTGGCTATTGTGGGTCATTCTTTGTCAATTTTCACCCTAGTGATTTCCCTGGGGAT
TTTCGTGTTTTTCAGAAAATTGACAACTATTTTTCCTTTGAATTGGAAATATAGGAAGGCATTGAGCCTT
GGCTGCCAAAGGGTAACCCTGCACAAGAACATGTTTCTTACTTACATTCTGAATTCTATGATTATCATCA
TCCACCTGGTTGAAGTAGTACCCAATGGAGAGCTCGTGCGAAGGGACCCGGTGAGCTGCAAGATTTTGCA
TTTTTTCCACCAGTACATGATGGCCTGCAACTATTTCTGGATGCTCTGTGAAGGGATCTATCTTCATACA
CTCATTGTCGTGGCTGTGTTTACTGAGAAGCAACGCTTGCGGTGGTATTATCTCTTGGGCTGGGGGTTCC
CGCTGGTGCCAACCACTATCCATGCTATTACCAGGGCCGTGTACTTCAATGACAACTGCTGGCTGAGTGT
GGAAACCCATTTGCTTTACATAATCCATGGACCTGTCATGGCGGCACTTGTGGTCAATTTCTTCTTTTTG
CTCAACATTGTCCGGGTGCTTGTGACCAAAATGAGGGAAACCCATGAGGCGGAATCCCACATGTACCTGA
AGGCTGTGAAGGCCACCATGATCCTTGTGCCCCTGCTGGGAATCCAGTTTGTCGTCTTTCCCTGGAGACC
TTCCAACAAGATGCTTGGGAAGATATATGATTACGTGATGCACTCTCTGATTCATTTCCAGGGCTTCTTT
GTTGCGACCATCTACTGCTTCTGCAACAATGAGGTCCAAACCACCGTGAAGCGCCAATGGGCCCAATTCA
AAATTCAGTGGAACCAGCGTTGGGGGAGGCGCCCCTCCAACCGCTCTGCTCGCGCTGCAGCCGCTGCTGC
GGAGGCTGGCGACATCCCAATTTACATCTGCCATCAGGAGCTGAGGAATGAACCAGCCAACAACCAAGGC
GAGGAGAGTGCTGAGATCATCCCTTTGAATATCATAGAGCAAGAGTCATCTGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC228419 representing NM_001164737
Red=Cloning site Green=Tags(s)

MQFSGEKISGQRDLQKSKMRFTFTSRCLALFLLLNHPTPILPAFSNQTYPTIEPKPFLYVVGRKKMMDAQ
YKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHP
ENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFRKLTTIFPLNWKYRKALSL
GCQRVTLHKNMFLTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHT
LIVVAVFTEKQRLRWYYLLGWGFPLVPTTIHAITRAVYFNDNCWLSVETHLLYIIHGPVMAALVVNFFFL
LNIVRVLVTKMRETHEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKMLGKIYDYVMHSLIHFQGFF
VATIYCFCNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQG
EESAEIIPLNIIEQESSA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001164737
ORF Size 1524 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001164737.1, NP_001158209
RefSeq ORF 1527
Locus ID 799
Cytogenetics 7q21.3
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 59.2 kDa
Gene Summary This gene encodes a high affinity receptor for the peptide hormone calcitonin and belongs to a subfamily of seven transmembrane-spanning G protein-coupled receptors. The encoded protein is involved in maintaining calcium homeostasis and in regulating osteoclast-mediated bone resorption. Polymorphisms in this gene have been associated with variations in bone mineral density and onset of osteoporosis. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)