RIZ1 (PRDM2) (NM_001135610) Human Tagged ORF Clone

CAT#: RC227715

PRDM2 (Myc-DDK-tagged)-Human PR domain containing 2, with ZNF domain (PRDM2), transcript variant 4

Product Images

Circular map for RC227715

• 

  Western blot validation of overexpression lysate (Cat# LY427635) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC227715 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified PRDM2 protein (Cat# TP327715). The protein was produced from HEK293T cells transfected with PRDM2 cDNA clone (Cat# RC227715) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RIZ1
• Synonyms: HUMHOXY1; KMT8; KMT8A; MTB-ZF; RIZ; RIZ1; RIZ2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC227715 representing NM_001135610
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAATCAGAACACTACTGAGCCTGTGGCGGCCACCGAGACCCTGGCTGAGGTACCCGAACATGTGCTGC
  GAGGACTTCCGGAGGAAGTGAGGCTTTTCCCTTCTGCTGTTGACAAGACCCGGATTGGTGTCTGGGCCAC
  TAAACCAATTTTAAAAGGCAAAAAATTTGGGCCATTTGTTGGTGATAAGAAAAAAAGATCTCAGGTTAAG
  AATAATGTATACATGTGGGAGGTGTATTACCCAAATTTGGGATGGATGTGCATTGATGCCACTGATCCAG
  AGAAGGGAAACTGGCTGCGATATGTGAATTGGGCTTGCTCAGGAGAAGAGCAAAATTTATTCCCACTGGA
  AATCAACAGAGCCATTTACTATAAAACTTTAAAGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTAC
  AATGGGGAAGACAACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGA
  GCTCCCCCAAGAGCCGGAAAGCTACAGCCTCCGCTTGGCGTCCCGATGCTCTCCACCAGCGGCCCCGTAC
  ATCACCAGGCAGTATAGGAAGGTCAAAGCTCCAGCTGCAGCCCAGTTCCAGGGACCATTCTTCAAAGAGT
  AGACACTCTGGCTGCTCCCTGACAGCACCTGAAGTGACCTGGAATCAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC227715 representing NM_001135610
  Red=Cloning site Green=Tags(s)
  
  MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVK
  NNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWY
  NGEDNPEIAAAIEEERASARSKRSSPKSRKATASAWRPDALHQRPRTSPGSIGRSKLQLQPSSRDHSSKS
  RHSGCSLTAPEVTWNQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001135610
• ORF Size: 678 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001135610.2
• RefSeq ORF: 681 bp
• Locus ID: 7799
• UniProt ID: Q13029
• Cytogenetics: 1p36.21
• Protein Families: Druggable Genome
• MW: 25.3 kDa
• Gene Summary: This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]