ETS1 (NM_001143820) Human Tagged ORF Clone

CAT#: RC227466

ETS1 (Myc-DDK-tagged)-Human v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) (ETS1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 618.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ETS1 (NM_001143820) Human Tagged ORF Clone
Symbol ETS1
Synonyms c-ets-1; ETS-1; EWSR2; p54
Vector pCMV6-Entry
Sequence Data
>RC227466 representing NM_001143820
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTACTTTGTGGATTCTGCTGGGAGCAGCCCCGTCCCTTACTCAGCGCCTCGTCCTGCAGTGGTGA
GGCAAGGACCTAGCAACACTTATGAAGATCCTCGAATGAACTGTGGTTTCCAGTCCAATTATCACCAGCA
AAGACCTTGCTACCCCTTTTGGGATGAGATGGCAACTCAGGAAGTTCCTACTGGTCTTGAACACTGTGTC
TCAGATATGGAATGTGCAGATGTCCCACTATTAACTCCAAGCAGCAAAGAAATGATGTCTCAAGCATTAA
AAGCTACTTTCAGTGGTTTCACTAAAGAACAGCAACGACTGGGGATCCCAAAAGACCCCCGGCAGTGGAC
AGAAACCCATGTTCGGGACTGGGTGATGTGGGCTGTGAATGAATTCAGCCTGAAAGGTGTAGACTTCCAG
AAGTTCTGTATGAATGGAGCAGCCCTCTGCGCCCTGGGTAAAGACTGCTTTCTCGAGCTGGCCCCAGACT
TTGTTGGGGACATCTTATGGGAACATCTAGAGATCCTGCAGAAAGAGGATGTGAAACCATATCAAGTTAA
TGGAGTCAACCCAGCCTATCCAGAATCCCGCTATACCTCGGATTACTTCATTAGCTATGGTATTGAGCAT
GCCCAGTGTGTTCCACCATCGGAGTTCTCAGAGCCCAGCTTCATCACAGAGTCCTATCAGACGCTCCATC
CCATCAGCTCGGAAGAGCTCCTCTCCCTCAAGTATGAGAATGACTACCCCTCGGTCATTCTCCGAGACCC
TCTCCAGACAGACACCTTGCAGAATGACTACTTTGCTATCAAACAAGAAGTCGTCACCCCAGACAACATG
TGCATGGGGAGGACCAGTCGTGGTAAACTCGGGGGCCAGGACTCTTTTGAAAGCATAGAGAGCTACGATA
GTTGTGATCGCCTCACCCAGTCCTGGAGCAGCCAGTCATCTTTCAACAGCCTGCAGCGTGTTCCCTCCTA
TGACAGCTTCGACTCAGAGGACTATCCGGCTGCCCTGCCCAACCACAAGCCCAAGGGCACCTTCAAGGAC
TATGTGCGGGACCGTGCTGACCTCAATAAGGACAAGCCTGTCATTCCTGCTGCTGCCCTAGCTGGCTACA
CAGGCAGTGGACCAATCCAGCTATGGCAGTTTCTTCTGGAATTACTCACTGATAAATCCTGTCAGTCTTT
TATCAGCTGGACAGGAGATGGCTGGGAATTCAAACTTTCTGACCCAGATGAGGTGGCCAGGAGATGGGGA
AAGAGGAAAAACAAACCTAAGATGAATTATGAGAAACTGAGCCGTGGCCTACGCTACTATTACGACAAAA
ACATCATCCACAAGACAGCGGGGAAACGCTACGTGTACCGCTTTGTGTGTGACCTGCAGAGCCTGCTGGG
GTACACCCCTGAGGAGCTGCACGCCATGCTGGACGTCAAGCCAGATGCCGACGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC227466 representing NM_001143820
Red=Cloning site Green=Tags(s)

MSYFVDSAGSSPVPYSAPRPAVVRQGPSNTYEDPRMNCGFQSNYHQQRPCYPFWDEMATQEVPTGLEHCV
SDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQ
KFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEH
AQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNM
CMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKD
YVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWG
KRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001143820
ORF Size 1455 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001143820.1, NP_001137292
RefSeq ORF 1458
Locus ID 2113
Cytogenetics 11q24.3
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Dorso-ventral axis formation, Pathways in cancer, Renal cell carcinoma
MW 55.2 kDa
Gene Summary This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)