FKBP51 (FKBP5) (NM_001145777) Human Tagged ORF Clone

CAT#: RC227059

Reviews ()
Write a review

FKBP5 (Myc-DDK-tagged)-Human FK506 binding protein 5 (FKBP5), transcript variant 4



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FKBP5
Synonyms AIG6; FKBP51; FKBP54; P54; PPIase; Ptg-10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC227059 representing NM_001145777
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTACTGATGAAGGTGCCAAGAACAATGAAGAAAGCCCCACAGCCACTGTTGCTGAGCAGGGAGAGG
ATATTACCTCCAAAAAAGACAGGGGAGTATTAAAGATTGTCAAAAGAGTGGGGAATGGTGAGGAAACGCC
GATGATTGGAGACAAAGTTTATGTCCATTACAAAGGAAAATTGTCAAATGGAAAGAAGTTTGATTCCAGT
CATGATAGAAATGAACCATTTGTCTTTAGTCTTGGCAAAGGCCAAGTCATCAAGGCATGGGACATTGGGG
TGGCTACCATGAAGAAAGGAGAGATATGCCATTTACTGTGCAAACCAGAATATGCATATGGCTCGGCTGG
CAGTCTCCCTAAAATTCCCTCGAATGCAACTCTCTTTTTTGAGATTGAGCTCCTTGATTTCAAAGGAGAG
GATTTATTTGAAGATGGAGGCATTATCCGGAGAACCAAACGGAAAGGAGAGGGATATTCAAATCCAAACG
AAGGAGCAACAGTAGAAATCCACCTGGAAGGCCGCTGTGGTGGAAGGATGTTTGACTGCAGAGATGTGGC
ATTCACTGTGGGCGAAGGAGAAGACCACGACATTCCAATTGGAATTGACAAAGCTCTGGAGAAAATGCAG
CGGGAAGAACAATGTATTTTATATCTTGGACCAAGGCCAAAGAATCCTGGGAGATGGATACCAAAGAAAA
ATTGGAGCAGGCTGCCATTGTCAAAGAGAAGGGAACCGTATACTTCAAGGTGTGTGAGTCCCTATGCAAT
CCTTTCCATCTCAAAGAATTTATTCAAGTGTTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC227059 representing NM_001145777
Red=Cloning site Green=Tags(s)

MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSS
HDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
DLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQ
REEQCILYLGPRPKNPGRWIPKKNWSRLPLSKRREPYTSRCVSPYAILSISKNLFKCW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001145777
ORF Size 804 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001145777.1, NP_001139249.1
RefSeq ORF 807 bp
Locus ID 2289
UniProt ID Q13451
Cytogenetics 6p21.31
Protein Families Druggable Genome
MW 29.9 kDa
Gene Summary The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]
Other products for "FKBP5"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.