TIMM50 (NM_001001563) Human Tagged ORF Clone

CAT#: RC224744

Reviews ()
Write a review

TIMM50 (Myc-DDK-tagged)-Human translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) (TIMM50), nuclear gene encoding mitochondrial protein



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TIMM50
Synonyms MGCA9; TIM50; TIM50L
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC224744 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCAGCTTTATCTCTGGGCAATAAGTGTGATCCCTTCCTTCGCTGCGTCCTTTGCAGGGGCGGTG
GCGCTCTGCAAGGCCCAAGGGGGCGTGGTCCAGATGACTTTGAATCCCAGTTGTCGCCCCCAGGGTCAGC
CAGGAGACTAGTCAGAAGCAAACGCGCCTGCGGCAATCCGCCCGATGCCTTTGGTCTCTCTCGGGCTTCC
GTCCACCCGCCCCTCCCCCGCGTTTCCATTGGCTGTACCTCCGGCCCGGGGCGGGCGAAGAGGGAGCGAG
TGGGCGGGGCCGCGTGGCGTCAGCGCAAGATGGCGGCCTCGGCAGCGGTGTTCTCGCGCTTGCGAAGCGG
GCTCCGGCTCGGCTCGCGGGGACTGTGCACGAGGTTGGCGACGCCGCCCCGCCGGGCCCCAGATCAGGCC
GCAGAGATCGGGAGCCGCGGGAGCACTAAGGCGCAAGGGCCACAGCAGCAGCCGGGCTCAGAGGGTCCCA
GCTATGCCAAAAAAGTTGCGCTCTGGCTTGCTGGGCTGCTTGGAGCTGGTGGGACTGTGAGCGTCGTCTA
TATCTTTGGAAACAACCCGGTGGACGAAAATGGTGCCAAGATTCCTGATGAGTTCGACAATGATCCAATT
CTGGTACAGCAGTTGCGCCGGACATACAAATATTTCAAAGATTATAGACAGATGATCATCGAGCCCACCA
GCCCTTGCCTTCTCCCAGACCCTCTGCAGGAACCGTACTACCAGCCACCCTACACGCTCGTTTTGGAGCT
CACCGGCGTCCTCTTGCATCCTGAGTGGTCGCTGGCCACTGGCTGGAGGTTTAAGAAGCGCCCAGGCATC
GAGACCTTGTTCCAGCAGCTTGCCCCTTTATATGAAATTGTCATCTTTACGTCAGAGACTGGCATGACTG
CGTTTCCACTCATTGATAGTGTGGACCCCCATGGCTTCATCTCCTACCGCCTATTCCGGGACGCCACAAG
ATACATGGATGGACACCATGTAAAGGATATTTCATGTCTGAATCGGGACCCAGCTCGAGTAGTAGTTGTG
GACTGCAAGAAGGAAGCCTTCCGCCTGCAGCCCTATAACGGCGTTGCCCTGCGGCCCTGGGACGGCAACT
CTGATGACCGGGTCTTGTTGGATCTGTCTGCCTTCCTCAAGACCATTGCACTGAATGGTGTGGAGGACGT
GCGAACCGTGCTGGAGCACTATGCCCTGGAGGATGACCCGCTGGCGGCTTTCAAACAGCGGCAAAGCCGG
CTAGAGCAGGAGGAGCAGCAGCGCCTGGCCGAGCTCTCCAAGTCCAACAAGCAGAACCTCTTCCTTGGCT
CCCTCACCAGCCGCTTGTGGCCTCGCTCCAAACAGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224744 protein sequence
Red=Cloning site Green=Tags(s)

MASALSLGNKCDPFLRCVLCRGGGALQGPRGRGPDDFESQLSPPGSARRLVRSKRACGNPPDAFGLSRAS
VHPPLPRVSIGCTSGPGRAKRERVGGAAWRQRKMAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQA
AEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPI
LVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGI
ETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVV
DCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSR
LEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001001563
ORF Size 1368 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001001563.3, NP_001001563.1
RefSeq Size 2572 bp
RefSeq ORF 1062 bp
Locus ID 92609
UniProt ID Q3ZCQ8
Cytogenetics 19q13.2
MW 50.5 kDa
Gene Summary This gene encodes a subunit of the TIM23 inner mitochondrial membrane translocase complex. The encoded protein functions as the receptor subunit that recognizes the mitochondrial targeting signal, or presequence, on protein cargo that is destined for the mitochondrial inner membrane and matrix. This protein may also play a role in maintaining the membrane permeability barrier, and knockdown of this gene in human cells results in the release of cytochrome c and apoptosis. [provided by RefSeq, Jul 2016]
Other products for "TIMM50"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.