GPR179 (NM_001004334) Human Tagged ORF Clone

CAT#: RC224221

GPR179 (Myc-DDK-tagged)-Human G protein-coupled receptor 179 (GPR179)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GPR179 (NM_001004334) Human Tagged ORF Clone
Symbol GPR179
Synonyms CSNB1E; GPR158L; GPR158L1
Vector pCMV6-Entry
Sequence Data
>RC224221 representing NM_001004334
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCACCAGGGGAGCGGTCATGCCCCCTCCTATGTGGGGGCTGCTGGGCTGCTGTTTTGTCTGTGCCT
GGGCTCTGGGGGGTCCACGGCCCATCCGCTCTCTGCCCCCTCTGTCTTCCCAAGTCAAGCCAGGATCTGT
ACCCATGCAGGTGCCCCTAGAGGGGGCCGAGGCCGCCCTCGCTTATCTCTACTCTGGAGATGCCCAGCAG
CTATCACAGGTGAATTGCAGTGAGCGCTATGAAGCGCGTGGGGCAGGAGCCATGCCAGGGCTCCCCCCAA
GCCTACAGGGGGCAGCGGGCACCCTTGCCCAGGCCGCCAATTTTCTCAACATGCTGCTGCAAGCCAACGA
CATCCGTGAGTCCAGTGTGGAGGAGGATGTGGAATGGTACCAGGCACTGGTCCGCAGCGTGGCCGAGGGG
GACCCAAGAGTGTACAGGGCTTTGCTGACCTTTAACCCTCCACCAGGGGCCAGCCACCTACAGCTGGCCC
TGCAGGCCACCCGGACTGGGGAGGAAACCATCCTGCAGGACTTGTCTGGGAACTGGGTGCAGGAGGAGAA
CCCTCCTGGGGACCTGGACACCCCTGCCCTGAAGAAGCGAGTGTTGACCAATGACCTAGGGAGCCTCGGC
AGCCCCAAGTGGCCGCAGGCAGATGGATATGTGGGGGACACGCAGCAGGTGAGGCTGTCTCCTCCTTTCC
TGGAATGCCAGGAGGGACGGCTCCGACCTGGATGGCTGATCACACTCTCTGCCACCTTCTATGGACTCAA
GCCAGACCTCAGCCCAGAAGTCAGGGGGCAGGTGCAGATGGACGTAGATCTCCAGAGTGTGGACATCAAT
CAGTGTGCAAGTGGCCCAGGCTGGTACTCTAACACACACCTGTGTGATCTCAACAGCACCCAGTGTGTTC
CCCTGGAGAGTCAGGGCTTTGTTCTTGGCCGCTACCTCTGCCGCTGCCGACCTGGATTCTACGGGGCAAG
CCCCTCTGGGGGGTTAGAGGAGAGTGACTTCCAGACTACCGGGCAATTCGGGTTCCCAGAAGGCAGATCT
GGGAGACTGCTGCAGTGTCTGCCATGTCCTGAGGGCTGCACCAGCTGCATGGATGCCACACCGTGCCTGG
TGGAAGAGGCCGCGGTGCTGCGGGCCGCTGTGCTGGCCTGCCAGGCCTGCTGCATGCTGGCCATCTTCCT
GAGCATGCTGGTCTCCTACCGCTGCCGCCGGAACAAGAGGATCTGGGCATCTGGAGTGGTCCTGCTGGAA
ACTGTCCTTTTTGGATTCCTGCTGCTTTACTTTCCTGTCTTCATCCTATACTTCAAGCCCAGTGTATTCC
GCTGCATCGCTCTTCGCTGGGTGCGGCTGCTGGGTTTTGCCATCGTCTACGGCACCATCATACTCAAGCT
TTACAGAGTGCTGCAGCTGTTTCTGTCTCGAACGGCCCAGCGGAGTGCCCTTCTGAGCAGCGGGCGGCTG
CTGCGGCGCCTGGGGCTGCTCCTGCTACCTGTGCTGGGCTTCCTGGCTGTGTGGACCGTGGGCGCCCTGG
AGCGAGGCATCCAGCACGCACCTCTGGTGATCCGAGGCCACACTCCCAGTGGCCGCCATTTCTACCTCTG
TCACCACGACCGCTGGGACTACATCATGGTTGTGGCTGAGCTGCTGCTGCTGTGCTGGGGCAGCTTCCTC
TGCTACGCCACACGGGCTGTGCTCTCGGCCTTCCATGAGCCACGCTACATGGGCATCGCCCTGCACAATG
AGCTACTGCTTTCCGCTGCCTTCCACACAGCCAGGTTTGTGCTGGTTCCCTCTCTGCACCCGGACTGGAC
CCTCCTCCTCTTCTTCTTCCACACCCACAGCACAGTCACCACCACGCTGGCTCTGATCTTCATCCCTAAG
TTCTGGAAGCTGGGGGCTCCTCCCCGGGAGGAGATGGTGGATGAGGTGTGTGAGGACGAGCTGGACCTGC
AGCACTCAGGCTCCTACCTTGGCAGCAGCATCGCCTCAGCCTGGAGTGAGCACAGCCTGGACCCTGGAGA
CATTCGGGACGAGCTGAAGAAGCTCTATGCCCAGCTAGAGGTCCACAAAACCAAGGAAATGGCCGCAAAC
AACCCCCACCTGCCCAAGAAGCGAGGCAGCTCATGCCAGGGACTGGGCCGCTCCTTCATGAGGTACCTGG
CGGAATTCCCCGAGGCCCTGGCCAGGCAGCACTCCCGGGACTCAGGATCCCCAGGCCACGGCAGCCTGCC
CGGCTCCTCCCGCCGCCGGCTCCTCAGCTCCAGCCTCCAGGAACCCGAGGGGACACCAGCTCTGCACAAG
TCCCGCAGCACCTATGACCAGCGCAGGGAGCAGGACCCGCCTCTTCTTGACTCACTGCTGAGGAGGAAGC
TGGCCAAGAAGGCCTCTCGAACAGAGAGCCGGGAGTCGGTGGAGGGGCCCCCTGCCCTGGGCTTCAGGTC
AGCCAGCGCCCACAACCTGACGGTGGGAGAGAGGCTACCCAGAGCCCGGCCCGCCTCTCTGCAGAAGTCG
CTCAGTGTGGCCAGCTCCAGGGAAAAGGCCTTGCTCATGGCCAGCCAGGCCTACCTGGAGGAGACCTACC
GGCAAGCAAAGGAGCGGGAGGAGCGGAAGAAGGCCAAGGCAGCCATGGCCAGCCTGGTGCGGAGGCCATC
AGCCAGGAGGCTGGAGCGGCCTCGAGGGGCCCCCCTGTCAGCTCCACCTTCCCCTGCCAAGAGCAGCAGC
GTGGACAGCTCTCACACCTCTGGGAGGCTTCATGAGGAGGCTAGGAGAAGGCTGCCTCATCCACCCATCA
GGCACCAGGTTTCTACCCCCATCTTGGCCCTGTCTGGGGGCCTGGGAGAGCCAAGGATGCTATCTCCCAC
CTCCACCTTGGCTCCAGCTCTGCTGCCAGCTCTAGCTCCAACCCCAGCCCCTGCCCTGGCACCAGTCCCA
GTATCCCCACAAAGCCCCAACTTACTCACCTACATCTGCCCCTGGGAGAACGCAGAACTGCCAGCCAAGC
AAGAAAATGTGCCCCAGGAAGGCCCCTCAGGGCCAGAGCGAGGCCACCACTCCCCTGCCCCAGCTCGAGC
CAGGCTCTGGAGGGCCCTCTCTGTTGCAGTAGAGAAAAGCAGGGCTGGGGAGAATGAGATGGACGCAGAG
GATGCACATCACCAGAGGGAAGCTAATGATGTGGACGAAGACAGGCCCAAGATCTTCCCTAAATCCCACA
GCCTCAAGGCCCCTGTTCAGCAGGGTTCCATGCGCAGCCTGGGGCTGGCGATTAAAGCTCTGACCCGTTC
TCGGAGCACCTACAGAGAGAAGGAGAGTGTGGAGGAGAGTCCCGAGGGGCAGAACAGCGGGACTGCGGGA
GAGAGTATGGGGGCACCCTCCCGATCGCCCAGGCTAGGCCGGCCCAAGGCGGTGAGTAAGCAGGCCGCTC
TTATCCCCTCCGATGACAAGGAGTCCCTCCAGAACCAACAGAACGCTCACACCAGCAGGATGCTCCAAGT
CTGTCAACGGGAGGGCAGCAGGGAACAAGAAGACAGAGGCAGGAGGATGACCCAGGGTCTAGGGGAACGG
AAAGCTGAGAGAGCAGGTAAAACAGGGCTTGCCATGCTGAGGCAAGTTTCCAGGGACAAAAACATCAAGC
AATCAAAAGAAACCCCTGTCGGGTGGCAGGAACTGCCCAAAGCTGGCCTCCAGTCCCTCGGCAGCGCTGA
CCACAGGGTGGCAGAGGTATGCCCCTGGGAGGTCACTGAATCAGAAACGCGTCAGCCAGACAGTGGCAAC
AAGGCCGAAATCTGCCCCTGGGAGACGAGTGAAGGAGCCCCAGAGTCGAGGGCACTAAGACAAGACCCAG
GTGACTCCCAAAAAAAGAGAGGGGAGGCCCGGGGAAAATCAGAGCCCATAGATGTGGTTCCCATGATGCG
GAAAAAGCCAGAGAGGCTGGTGAGGGAGCAGGAAGCAGTGTGTCCCTGGGAGAGTGCCGATCGAGGAGGT
CTGTCCCCTGGGTCAGCTCCTCAGGACCCTGGCAGAATCAGAGACAAATCTGAGGCGGGGGACAGTGTGG
AGGCCAGGAAGGTGGAGAAGCCTGGGTGGGAAGCTGCTGGCCCAGAAGCTCATACCCCTGACATCACCAA
GGCAGAGCCGTGTCCCTGGGAGGCAAGTGAAGGAGGCGAGGATGGGAAACCAGCCCAAGAGGCAGTGAAG
GATCTCCCTCAGGAAAAGCAGAAAACCAGGAAAGCAACCTTTTGGAAAGAACAGAAACCGGGAGGAGACT
TGGAGTCTCTTTGTCCATGGGAGAGTACAGATTTCCGGGGCCCCTCAGCAGTCTCAATTCAGGCCCCAGG
AAGCTCAGAGTGTTCAGGGAGTTTGGGCAGTGGCATTGCTGAAGTGTGTCTGTGGGAGGCAGGAGATGCT
CCTGCTATCCAGAAAGCAGAGATCTGTCCCTGGGAGCTGGATGATAACGTGATGGGGCAGGAAATGCTGA
GTCTGGGGACAGGTAGAGAATCTCTTCAAGAAAAGGAAAAAGCCTCCAGAAAAGGAAGCTTTGGAGAGAT
GGGGGAACAAACTGTGAAAGCAGTGCAGAAATTAAGTCAACAGCAGGAGTCAGTTTGTCCCAGGGAGAGC
ACGGTCCCTGGGCACTCCAGCCCATGTCTAGACAATTCCTCATCCAAAGCTGGTAGCCAATTCCTATGCA
ATGGAGGAAGCAGAGCAACGCAGGTGTGTCCACAGGAAGATCTCAGGCCGGAGGCACAGGAAGCAACACC
TGCCAAAACAGAAATCTGTCCCTGGGAGGTAAATGAAAGAACAAGAGAGGAATGGACATCAGCACAGGTG
CCAAGAGGAGGAGAATCTCAAAAGGACAAGGAGAAAATGCCTGGAAAATCGGAAATCGAAGATGTCACAG
CTTGGGAAAAGCCTGAGGGGCAGATCCAAAAGCAAGAAGCGGTCGGCCCCTGGGAGAGTGTGGACCCTGG
CAGCTTCTCCCCACAACCACGTCCTCAAGACACAGAGAGACCCCAAACCCTTCTCCAGATGTCAGGCAGT
GTGGGAAGCAAAGCTGCCGACATTTGCCCTTTGGATGTGGAGGAAAACTTGACTGCTGGGAAGGCAGAAA
TCTGTCCCTGGGAGGTGGGTGCTGGAGCAGGGGAGGAAAGGGCTTTGGGAGCTGAGGCCATTAGGAAATC
TCCAAATGATACAGGCAAGGTTTCTGCAGATCTTGGACCCAGGGAGAGAGCTGTTACTGCTCCAGAGAAG
CCACAGAAGCCAACCCCAGAGTGGGAGGTGGCTTGTCCCTGGGGGAGTGTGGGTCCAGGGGCCTGTTCTC
AGCATCCAGGTACTCTAGATGCTGATGGACCAAAAGCTGGGTTCCAGGAACTGGATCATATGGGCTGCAG
GCCAGGTGAAGTGTGTCCCTGGGAAGCACAGGAAGCTGCTACCAGTGAAAAAGCCAAGATCTGTCCCTGG
GAGGTAAGTGAAGGAACTACTGGGAAGGGATTGGACCAAAAGGCAGGGAGTGAATCAGCAGAGCAGAGGG
AGAAAGCTCTAGAAAAGGGGAGACTCACTTCCCTGGGAGAAGACGTATCAAAAGGGATGGCAAAACTGTG
TCAACAACAGGAAACTATTTGTATTTGGGAGAACAAGGACTTGAGGGAATCCCCTGCTCAGGCCCCCAAG
ATCTCAGACTTGCCCAGCAGCATGAGTAGTGAAGTGGCAGAGGGACATTCCTTGGAAGCAACAGAGAAGG
GGGACCTGAGACAAGACCCAAAGACAGGTTCCTTCCCAGAACACATAACCCAAGAAAAAGCTCCAGCTGC
AGACACAGAAGAATTCACTACTGAAGATGGGGAAAAAACAAGCCATGAGCTACAATCCGTCTGTCCATGG
GAGACCACTGCCCCAGCAGATTCCGTCTCTCACCTAGACAGACAGCGCCCTGACCAACCTAAAGCTAGCT
CCCAGAGACTGGTCAGCACTGGGGGCAGGGCCGCTGACGTGTGCCCATGGGATGTTCCTGATGCAGGTGT
GTATAAATCTGACAGCAGTGCCAAGGCTGAGACCTGTCCCTGGGAAGTGACTGAAAGAATCCCTGTCAAA
GGGGTGTCAAGGCAGGATGGAAAAGGGGACTCTCAAGAAGAGAAAGGCAGAGCCCCAGAAAAATCAGAGC
CAAAAGGTGTGCCAGTTCAGAAAAAGCCAGAGATGGCAGACTTCAGGCAGCAGGAGGCTGTGTGTCCCTG
GGAGAGTCAAGATGGCAAGGGTCTGTCCCCACAGCCAGCCCCAGATGCTTCTGACAGAAGCAGAGGCAGT
TCTGAGGCAGCAGGCAGTGTGGAGACCAGGGTAGCGGAAGTGTGTCTGTGGGAAGTGGTAGAGGCTCCCT
CTGCCAAGAAAGCAGAGATCTGCCCTTGGGAGGCGGGTGGAGGAGCAGCAGAGGAAGGGGAACAGGAAAG
AGAATCACAAGGGCAAGGAGAGATGTTCCTTCAGAAGGCAGGACCTGGAGGGACGGAAGAACACTTCTCA
AAAGCAGCAGCAAAGCCCAGAGAGCAGGAGGCAGTCTGCCCTGGGGAAGGCACAGGCTCAGGAGGGCTCT
TGCCCCAGTCAGGTGCCCTGGACCCAGAACTCAAAGTCAGCCCCAAGGAAGCAGGCAGCATGGGAAGCAG
GATGGCAGAGCTGTGCCAATGGGAAATCACAGATCCAGAAGGAAATAAAATAAAGGGTACCATGGCAGAC
ATCTGTCCTGGGGAGGAAACTGGAGTCCCATCTGAGGAATCTGGCCTCCTGGCTTTAACAGCAACTCGGA
GAGAATTTTTCCCCACAGCTCCTGAAAAACCACTATGCCTTTTAGTCCATGGGCCTCTGGATCACTTCTT
TCCAGAAAGCAAAATCCCCTGCCCCAAGGTAAGCAGGCCAGCCAGTACTTTCACTCTAGAAGGTGTCAGA
GAACTACAAGGACCTTCAGGGCTTGAGCCAAGGACCAGCTTAGCCCCAGAGCCAAGTCTCCAGGAAGCTG
AGTCTCAGTCTTCGTCCTTAACTGAAGACTCAGGCCAAGTGGCTTTTGAAGCTCAGTATGAAGAATTCAC
CCCTCCCACTGTCTATCCTTGGGATTGGGAG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC224221 representing NM_001004334
Red=Cloning site Green=Tags(s)

MGTRGAVMPPPMWGLLGCCFVCAWALGGPRPIRSLPPLSSQVKPGSVPMQVPLEGAEAALAYLYSGDAQQ
LSQVNCSERYEARGAGAMPGLPPSLQGAAGTLAQAANFLNMLLQANDIRESSVEEDVEWYQALVRSVAEG
DPRVYRALLTFNPPPGASHLQLALQATRTGEETILQDLSGNWVQEENPPGDLDTPALKKRVLTNDLGSLG
SPKWPQADGYVGDTQQVRLSPPFLECQEGRLRPGWLITLSATFYGLKPDLSPEVRGQVQMDVDLQSVDIN
QCASGPGWYSNTHLCDLNSTQCVPLESQGFVLGRYLCRCRPGFYGASPSGGLEESDFQTTGQFGFPEGRS
GRLLQCLPCPEGCTSCMDATPCLVEEAAVLRAAVLACQACCMLAIFLSMLVSYRCRRNKRIWASGVVLLE
TVLFGFLLLYFPVFILYFKPSVFRCIALRWVRLLGFAIVYGTIILKLYRVLQLFLSRTAQRSALLSSGRL
LRRLGLLLLPVLGFLAVWTVGALERGIQHAPLVIRGHTPSGRHFYLCHHDRWDYIMVVAELLLLCWGSFL
CYATRAVLSAFHEPRYMGIALHNELLLSAAFHTARFVLVPSLHPDWTLLLFFFHTHSTVTTTLALIFIPK
FWKLGAPPREEMVDEVCEDELDLQHSGSYLGSSIASAWSEHSLDPGDIRDELKKLYAQLEVHKTKEMAAN
NPHLPKKRGSSCQGLGRSFMRYLAEFPEALARQHSRDSGSPGHGSLPGSSRRRLLSSSLQEPEGTPALHK
SRSTYDQRREQDPPLLDSLLRRKLAKKASRTESRESVEGPPALGFRSASAHNLTVGERLPRARPASLQKS
LSVASSREKALLMASQAYLEETYRQAKEREERKKAKAAMASLVRRPSARRLERPRGAPLSAPPSPAKSSS
VDSSHTSGRLHEEARRRLPHPPIRHQVSTPILALSGGLGEPRMLSPTSTLAPALLPALAPTPAPALAPVP
VSPQSPNLLTYICPWENAELPAKQENVPQEGPSGPERGHHSPAPARARLWRALSVAVEKSRAGENEMDAE
DAHHQREANDVDEDRPKIFPKSHSLKAPVQQGSMRSLGLAIKALTRSRSTYREKESVEESPEGQNSGTAG
ESMGAPSRSPRLGRPKAVSKQAALIPSDDKESLQNQQNAHTSRMLQVCQREGSREQEDRGRRMTQGLGER
KAERAGKTGLAMLRQVSRDKNIKQSKETPVGWQELPKAGLQSLGSADHRVAEVCPWEVTESETRQPDSGN
KAEICPWETSEGAPESRALRQDPGDSQKKRGEARGKSEPIDVVPMMRKKPERLVREQEAVCPWESADRGG
LSPGSAPQDPGRIRDKSEAGDSVEARKVEKPGWEAAGPEAHTPDITKAEPCPWEASEGGEDGKPAQEAVK
DLPQEKQKTRKATFWKEQKPGGDLESLCPWESTDFRGPSAVSIQAPGSSECSGSLGSGIAEVCLWEAGDA
PAIQKAEICPWELDDNVMGQEMLSLGTGRESLQEKEKASRKGSFGEMGEQTVKAVQKLSQQQESVCPRES
TVPGHSSPCLDNSSSKAGSQFLCNGGSRATQVCPQEDLRPEAQEATPAKTEICPWEVNERTREEWTSAQV
PRGGESQKDKEKMPGKSEIEDVTAWEKPEGQIQKQEAVGPWESVDPGSFSPQPRPQDTERPQTLLQMSGS
VGSKAADICPLDVEENLTAGKAEICPWEVGAGAGEERALGAEAIRKSPNDTGKVSADLGPRERAVTAPEK
PQKPTPEWEVACPWGSVGPGACSQHPGTLDADGPKAGFQELDHMGCRPGEVCPWEAQEAATSEKAKICPW
EVSEGTTGKGLDQKAGSESAEQREKALEKGRLTSLGEDVSKGMAKLCQQQETICIWENKDLRESPAQAPK
ISDLPSSMSSEVAEGHSLEATEKGDLRQDPKTGSFPEHITQEKAPAADTEEFTTEDGEKTSHELQSVCPW
ETTAPADSVSHLDRQRPDQPKASSQRLVSTGGRAADVCPWDVPDAGVYKSDSSAKAETCPWEVTERIPVK
GVSRQDGKGDSQEEKGRAPEKSEPKGVPVQKKPEMADFRQQEAVCPWESQDGKGLSPQPAPDASDRSRGS
SEAAGSVETRVAEVCLWEVVEAPSAKKAEICPWEAGGGAAEEGEQERESQGQGEMFLQKAGPGGTEEHFS
KAAAKPREQEAVCPGEGTGSGGLLPQSGALDPELKVSPKEAGSMGSRMAELCQWEITDPEGNKIKGTMAD
ICPGEETGVPSEESGLLALTATRREFFPTAPEKPLCLLVHGPLDHFFPESKIPCPKVSRPASTFTLEGVR
ELQGPSGLEPRTSLAPEPSLQEAESQSSSLTEDSGQVAFEAQYEEFTPPTVYPWDWE

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001004334
ORF Size 7101 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001004334.1, NM_001004334.2, NM_001004334.3, NP_001004334
RefSeq Size 7980
RefSeq ORF 7104
Locus ID 440435
Cytogenetics 17q12
Protein Families Transmembrane, Druggable Genome
MW 257.2 kDa
Gene Summary This gene encodes a member of the glutamate receptor subfamily of G protein-coupled receptors. The encoded protein has an EGF-like calcium binding domain and a seven transmembrane domain in the N-terminal region of the protein. Mutations in this gene are associated with congenital stationary night blindness type 1E. [provided by RefSeq, Apr 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)